Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat C-C motif chemokine 3 protein (Ccl3), Active Protein

Recombinant Rat C-C motif chemokine 3 protein (Ccl3), Active Protein is a purified Active Recombinant Protein. Purity: >98% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Rat (Rattus norvegicus) . Target Name: C-C motif chemokine 3 protein (Ccl3) . Accession Number: P50229; Ccl3; Mip1a; Scya3. Expression Region: 24-92aa. Tag Info: Tag-Free. Theoretical MW: 7.9kda. Target Synonyms: Macrophage inflammatory protein 1-alpha; Small-inducible cytokine A3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat C-C motif chemokine 3 protein (Ccl3), Active Protein is a purified Active Recombinant Protein.

Accession Number

P50229; Ccl3; Mip1a; Scya3

Expression Region

24-92aa

Host

E. coli

Target

C-C motif chemokine 3 protein (Ccl3)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>98% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

7.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Macrophage inflammatory protein 1-alpha; Small-inducible cytokine A3

Species

Rat (Rattus norvegicus)

Protein Name

Active Recombinant Protein

AA Sequence

APYGADTPTACCFSYGRQIPRKFIADYFETSSLCSQPGVIFLTKRNRQICADPKETWVQEYITELELNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-500 1x 500 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-100 1x 100 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL
BNC940977-100 1x 100 µL

TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
BNC040391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
BNC680043-100 1x 100 µL

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details