Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C motif chemokine 3 protein (CCL3), partial , Active Protein

Recombinant Human C-C motif chemokine 3 protein (CCL3), partial , Active Protein is a purified Active Recombinant Protein. Purity: >96% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: C-C motif chemokine 3 protein (CCL3) . Accession Number: P10147; CCL3; G0S19-1; MIP1A; SCYA3. Expression Region: 23-92aa. Tag Info: Tag-Free. Theoretical MW: 7.8kda. Target Synonyms: G0/G1 switch regulatory protein 19-1; MIP-1-alpha; PAT 464.1; SIS-beta; Small-inducible cytokine A3 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human C-C motif chemokine 3 protein (CCL3), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P10147; CCL3; G0S19-1; MIP1A; SCYA3

Expression Region

23-92aa

Host

E. coli

Target

C-C motif chemokine 3 protein (CCL3)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>96% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

7.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

G0/G1 switch regulatory protein 19-1; MIP-1-alpha; PAT 464.1; SIS-beta; Small-inducible cytokine A3

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL
BNC681035-100 1x 100 µL

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF647 conjugate, 0.1mg/mL
BNC471035-100 1x 100 µL

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
BNC680745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL
BNC401081-500 1x 500 µL

CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (MLP/842), CF568 conjugate, 0.1mg/mL
BNC680842-100 1x 100 µL

MUC2 (MLP/842), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (GFR450), CF405S conjugate, 0.1mg/mL
BNC040450-100 1x 100 µL

EGFR (GFR450), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details