Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Trefoil factor 3 protein (TFF3), Active Protein

Recombinant Human Trefoil factor 3 protein (TFF3), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Trefoil factor 3 protein (TFF3) . Accession Number: Q07654; TFF3; ITF; TFI. Expression Region: 22-80aa. Tag Info: Tag-Free. Theoretical MW: 6.6kda. Target Synonyms: Intestinal trefoil factor; Polypeptide P1.B; hP1.B Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Trefoil factor 3 protein (TFF3), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q07654; TFF3; ITF; TFI

Expression Region

22-80aa

Host

E. coli

Target

Trefoil factor 3 protein (TFF3)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Signal Transduction

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

6.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Intestinal trefoil factor; Polypeptide P1.B; hP1.B

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDIK1L (Serine/Threonine-protein Kinase PDIK1L, PDLIM1-interacting Kinase 1-like, PDIK1L, CLIK1L, RP11-96L14.4, STK35L2) (PE)
131088-PE 100 µL

PDIK1L (Serine/Threonine-protein Kinase PDIK1L, PDLIM1-interacting Kinase 1-like, PDIK1L, CLIK1L, RP11-96L14.4, STK35L2) (PE)

Sign In for Pricing
View Details
5- (4-Isopropylphenyl) -1h-pyrazole-4-carbaldehyde
434501-01 100 mg

5- (4-Isopropylphenyl) -1h-pyrazole-4-carbaldehyde

Sign In for Pricing
View Details
5- (4-Isopropylphenyl) -1h-pyrazole-4-carbaldehyde
434501-02 250 mg

5- (4-Isopropylphenyl) -1h-pyrazole-4-carbaldehyde

Sign In for Pricing
View Details
PTK6 Antibody
MBS7050115-01 0.05 mg

PTK6 Antibody

Sign In for Pricing
View Details
PTK6 Antibody
MBS7050115-02 0.1 mg

PTK6 Antibody

Sign In for Pricing
View Details
PTK6 Antibody
MBS7050115-03 5x 0.1 mg

PTK6 Antibody

Sign In for Pricing
View Details