Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-4 (Il4), Active Protein

Recombinant Mouse Interleukin-4 (Il4), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: Interleukin-4 (Il4) . Accession Number: P07750; Il4. Expression Region: 21-140aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 14.6kda. Target Synonyms: Interleukin-4; IL-4; IL4; B-cell IgG differentiation factor; B-cell growth factor 1; B-cell stimulatory factor 1; BSF-1; IGG1 induction factor; Lymphocyte stimulatory factor 1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Interleukin-4 (Il4), Active Protein is a purified Active Recombinant Protein.

Accession Number

P07750; Il4

Expression Region

21-140aa

Host

Mammalian Cells

Target

Interleukin-4 (Il4)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

14.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Interleukin-4; IL-4; IL4; B-cell IgG differentiation factor; B-cell growth factor 1; B-cell stimulatory factor 1; BSF-1; IGG1 induction factor; Lymphocyte stimulatory factor 1

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPP8 Rabbit pAb
E47R8295 100 µL

DPP8 Rabbit pAb

Sign In for Pricing
View Details
VCIP 135 (VCPIP1) (NM_025054) Human Over-expression Lysate
LC410929 20 µg

VCIP 135 (VCPIP1) (NM_025054) Human Over-expression Lysate

Sign In for Pricing
View Details
ERG/KCNH2 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-1815R-PE-Cy5.5 100 µL

ERG/KCNH2 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Human Pancreatic Polypeptide/PP Affinity Purified PAb
AF6297-SP 25 µg

Human Pancreatic Polypeptide/PP Affinity Purified PAb

Sign In for Pricing
View Details
NQO1 (A180) PE
sc-32793 PE 200 µg/mL

NQO1 (A180) PE

Sign In for Pricing
View Details
Recombinant Pyrococcus horikoshii DNA polymerase II small subunit (polB), partial
MBS1004534 Inquire

Recombinant Pyrococcus horikoshii DNA polymerase II small subunit (polB), partial

Sign In for Pricing
View Details