Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-4 (Il4), Active Protein

Recombinant Mouse Interleukin-4 (Il4), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: Interleukin-4 (Il4) . Accession Number: P07750; Il4. Expression Region: 21-140aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 14.6kda. Target Synonyms: Interleukin-4; IL-4; IL4; B-cell IgG differentiation factor; B-cell growth factor 1; B-cell stimulatory factor 1; BSF-1; IGG1 induction factor; Lymphocyte stimulatory factor 1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Interleukin-4 (Il4), Active Protein is a purified Active Recombinant Protein.

Accession Number

P07750; Il4

Expression Region

21-140aa

Host

Mammalian Cells

Target

Interleukin-4 (Il4)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

14.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Interleukin-4; IL-4; IL4; B-cell IgG differentiation factor; B-cell growth factor 1; B-cell stimulatory factor 1; BSF-1; IGG1 induction factor; Lymphocyte stimulatory factor 1

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human FCGRT/B2M Protein
MBS8249026-01 0.01 mg

Recombinant Human FCGRT/B2M Protein

Sign In for Pricing
View Details
Recombinant Human FCGRT/B2M Protein
MBS8249026-02 0.05 mg

Recombinant Human FCGRT/B2M Protein

Sign In for Pricing
View Details
Recombinant Human FCGRT/B2M Protein
MBS8249026-03 0.5 mg

Recombinant Human FCGRT/B2M Protein

Sign In for Pricing
View Details
Recombinant Human FCGRT/B2M Protein
MBS8249026-04 5x 0.5 mg

Recombinant Human FCGRT/B2M Protein

Sign In for Pricing
View Details
AS160 Peptide
AF4682-BP 1 mg

AS160 Peptide

Sign In for Pricing
View Details
Rabbit Polyclonal LIN-41/TRIM71 Antibody [Alexa Fluor 532]
NBP1-76281AF532 0.1 mL

Rabbit Polyclonal LIN-41/TRIM71 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details