Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 2 (FGF2), Active Protein

Recombinant Human Fibroblast growth factor 2 (FGF2), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Fibroblast growth factor 2 (FGF2) . Accession Number: P09038-4; FGF2. Expression Region: 143-288aa. Tag Info: Tag-Free. Theoretical MW: 16.3kda. Target Synonyms: Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Fibroblast growth factor 2 (FGF2), Active Protein is a purified Active Recombinant Protein.

Accession Number

P09038-4; FGF2

Expression Region

143-288aa

Host

E. coli

Target

Fibroblast growth factor 2 (FGF2)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Signal Transduction

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein of Isoform 1

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRCC1 Rabbit Polyclonal Antibody (Biotin)
orb2102446 100 µL

KRCC1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Bovine Serum
IHR-8131 20 mL

Bovine Serum

Sign In for Pricing
View Details
BRAP sgRNA CRISPR Lentivector (Human) (Target 1)
K0193302 1.0 µg DNA

BRAP sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human Influenza A virus (FluA) antibody (IgM) ELISA KIT
ED0495Hu-01 96 Well

Human Influenza A virus (FluA) antibody (IgM) ELISA KIT

Sign In for Pricing
View Details
Human Influenza A virus (FluA) antibody (IgM) ELISA KIT
ED0495Hu-02 5x 96 Tests

Human Influenza A virus (FluA) antibody (IgM) ELISA KIT

Sign In for Pricing
View Details
Human Influenza A virus (FluA) antibody (IgM) ELISA KIT
ED0495Hu-03 10x 96 Tests

Human Influenza A virus (FluA) antibody (IgM) ELISA KIT

Sign In for Pricing
View Details