Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galectin-3 protein (LGALS3), Active Protein

Recombinant Human Galectin-3 protein (LGALS3), Active Protein is a purified Active Recombinant Protein. Purity: >98% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Galectin-3 protein (LGALS3) . Accession Number: P17931; LGALS3; MAC2. Expression Region: 2-250aa. Tag Info: Tag-Free. Theoretical MW: 26.0kda. Target Synonyms: Gal-3; Carbohydrate-binding protein 35; CBP 35; Galactose-specific lectin 3; Galactoside-binding protein Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Galectin-3 protein (LGALS3), Active Protein is a purified Active Recombinant Protein.

Accession Number

P17931; LGALS3; MAC2

Expression Region

2-250aa

Host

E. coli

Target

Galectin-3 protein (LGALS3)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Neuroscience

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>98% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Gal-3; Carbohydrate-binding protein 35; CBP 35; Galactose-specific lectin 3; Galactoside-binding protein

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GrxD Antibody (FITC)
orb687386-01 50 μL

GrxD Antibody (FITC)

Sign In for Pricing
View Details
GrxD Antibody (FITC)
orb687386-02 100 µL

GrxD Antibody (FITC)

Sign In for Pricing
View Details
Human SLC11A1 Knockout A549 cell line
GTR15419012 1 Vial

Human SLC11A1 Knockout A549 cell line

Sign In for Pricing
View Details
CD71/Transferrin receptor Polyclonal Antibody Cy5 Conjugated
orb1540679 100 µL

CD71/Transferrin receptor Polyclonal Antibody Cy5 Conjugated

Sign In for Pricing
View Details
KPNB1 Antibody
orb791304 2 mg

KPNB1 Antibody

Sign In for Pricing
View Details
MIRacle™ hsa-miR-3618 miRNA Agomir/Antagomir
AM1923 2 OD, 4 OD, 50 OD

MIRacle™ hsa-miR-3618 miRNA Agomir/Antagomir

Sign In for Pricing
View Details