Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NAD-dependent malic enzyme, mitochondrial protein (ME2), Active Protein

Recombinant Human NAD-dependent malic enzyme, mitochondrial protein (ME2), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: NAD-dependent malic enzyme, mitochondrial protein (ME2) . Accession Number: P23368; ME2. Expression Region: 19-584aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 64.4kda. Target Synonyms: NAD-ME; Malic enzyme 2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human NAD-dependent malic enzyme, mitochondrial protein (ME2), Active Protein is a purified Active Recombinant Protein.

Accession Number

P23368; ME2

Expression Region

19-584aa

Host

E. coli

Target

NAD-dependent malic enzyme, mitochondrial protein (ME2)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Signal Transduction

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

64.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

NAD-ME; Malic enzyme 2

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITE+HHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Floor Standing Shaking Incubator BSFT-102
BSFT-102 1 Unit

Floor Standing Shaking Incubator BSFT-102

Sign In for Pricing
View Details
Ghrelin Acetate
TRC-G932011-1MG 1 mg

Ghrelin Acetate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS803875 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
4,5-Dichloro-acenaphthene
TRC-D434525-2.5MG 2.5 mg

4,5-Dichloro-acenaphthene

Sign In for Pricing
View Details
Ly-76 / TER-119 Rat Monoclonal Antibody [Clone ID: TER-119]
AM31858BT-N 100 µg

Ly-76 / TER-119 Rat Monoclonal Antibody [Clone ID: TER-119]

Sign In for Pricing
View Details
SUN2 (Center) Rabbit Polyclonal Antibody
AP54462PU-N 400 µL

SUN2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details