Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NAD-dependent malic enzyme, mitochondrial protein (ME2), Active Protein

Recombinant Human NAD-dependent malic enzyme, mitochondrial protein (ME2), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: NAD-dependent malic enzyme, mitochondrial protein (ME2) . Accession Number: P23368; ME2. Expression Region: 19-584aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 64.4kda. Target Synonyms: NAD-ME; Malic enzyme 2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human NAD-dependent malic enzyme, mitochondrial protein (ME2), Active Protein is a purified Active Recombinant Protein.

Accession Number

P23368; ME2

Expression Region

19-584aa

Host

E. coli

Target

NAD-dependent malic enzyme, mitochondrial protein (ME2)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Signal Transduction

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

64.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

NAD-ME; Malic enzyme 2

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITE+HHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Kidney
CB509909 1 Block

Frozen Tissue Blocks, Kidney

Sign In for Pricing
View Details
IFNGR1 (NM_000416) Human Over-expression Lysate
LC400147 20 µg

IFNGR1 (NM_000416) Human Over-expression Lysate

Sign In for Pricing
View Details
2-Ethylpentanoic Acid
TRC-E818000-250MG 250 mg

2-Ethylpentanoic Acid

Sign In for Pricing
View Details
Tissue Protein Lysate, Lung
CP565445 150 µg

Tissue Protein Lysate, Lung

Sign In for Pricing
View Details
IFT27 Polyclonal Antibody
E-AB-18926-01 20 µL

IFT27 Polyclonal Antibody

Sign In for Pricing
View Details
IFT27 Polyclonal Antibody
E-AB-18926-02 60 µL

IFT27 Polyclonal Antibody

Sign In for Pricing
View Details