Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-nerve growth factor (NGF), Active Protein

Recombinant Human Beta-nerve growth factor (NGF), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Beta-nerve growth factor (NGF) . Accession Number: P01138; NGF. Expression Region: 122-241aa. Tag Info: Tag-Free. Theoretical MW: 13.4kda. Target Synonyms: Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Beta-nerve growth factor (NGF), Active Protein is a purified Active Recombinant Protein.

Accession Number

P01138; NGF

Expression Region

122-241aa

Host

E. coli

Target

Beta-nerve growth factor (NGF)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Neuroscience

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSUN5 Rabbit Polyclonal Antibody
HA500544 100 µL

NSUN5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD163 (Monocyte & Macrophage Marker) (M130/2164), CF594 conjugate, 0.1mg/mL
BNC942164-500 1x 500 µL

CD163 (Monocyte & Macrophage Marker) (M130/2164), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nanog Recombinant Rabbit Monoclonal Antibody [SC05-70]
ET1610-2 100 µL

Nanog Recombinant Rabbit Monoclonal Antibody [SC05-70]

Sign In for Pricing
View Details
Uncoated Rat LIFR (Leukemia Inhibitory Factor Receptor) ELISA Kit
E-UNEL-R0035-01 5x 96 Tests

Uncoated Rat LIFR (Leukemia Inhibitory Factor Receptor) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat LIFR (Leukemia Inhibitory Factor Receptor) ELISA Kit
E-UNEL-R0035-02 15x 96 Tests

Uncoated Rat LIFR (Leukemia Inhibitory Factor Receptor) ELISA Kit

Sign In for Pricing
View Details
GalNacb(1,4)Galb-O-BSA Colloidal Gold Conjugate, 1mL 20nm
CCG-1016-20 1 mL

GalNacb(1,4)Galb-O-BSA Colloidal Gold Conjugate, 1mL 20nm

Sign In for Pricing
View Details