Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-nerve growth factor (NGF), Active Protein

Recombinant Human Beta-nerve growth factor (NGF), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Beta-nerve growth factor (NGF) . Accession Number: P01138; NGF. Expression Region: 122-241aa. Tag Info: Tag-Free. Theoretical MW: 13.4kda. Target Synonyms: Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Beta-nerve growth factor (NGF), Active Protein is a purified Active Recombinant Protein.

Accession Number

P01138; NGF

Expression Region

122-241aa

Host

E. coli

Target

Beta-nerve growth factor (NGF)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Neuroscience

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIRE (NM_000383) Human Recombinant Protein
TP313497M 100 µg

AIRE (NM_000383) Human Recombinant Protein

Sign In for Pricing
View Details
CKMT2 (NM_001825) Human Recombinant Protein
TP306607M 100 µg

CKMT2 (NM_001825) Human Recombinant Protein

Sign In for Pricing
View Details
(7Alpha,17Alpha)- 9,17-Dihydroxy-3-oxo-pregn-4-ene-7,21-dicarboxylic Acid Di-Gamma-lactone
TRC-D453900-5MG 5 mg

(7Alpha,17Alpha)- 9,17-Dihydroxy-3-oxo-pregn-4-ene-7,21-dicarboxylic Acid Di-Gamma-lactone

Sign In for Pricing
View Details
CGK2 (PRKG2) (NM_006259) Human Over-expression Lysate
LY401884 100 µg

CGK2 (PRKG2) (NM_006259) Human Over-expression Lysate

Sign In for Pricing
View Details
Accuris™ Compact Balance, 5000 grams, readability 0.1grams, 230V
W3300-5K-E 1 Each

Accuris™ Compact Balance, 5000 grams, readability 0.1grams, 230V

Sign In for Pricing
View Details
Replication Protein A2 (RPA2) (RPA2/2106), 0.2mg/mL
BNUB2106-100 1x 100 µL

Replication Protein A2 (RPA2) (RPA2/2106), 0.2mg/mL

Sign In for Pricing
View Details