Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transforming growth factor beta-1 proprotein (TGFB1), partial , Active Protein

Recombinant Human Transforming growth factor beta-1 proprotein (TGFB1), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Transforming growth factor beta-1 proprotein (TGFB1) . Accession Number: P01137; TGFB1. Expression Region: 279-390aa. Tag Info: Tag-Free. Theoretical MW: 12.8kda. Target Synonyms: Transforming Growth Factor Beta-1; TGF-Beta-1; Latency-Associated Peptide; LAP; TGFB1; TGFB Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Transforming growth factor beta-1 proprotein (TGFB1), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P01137; TGFB1

Expression Region

279-390aa

Host

Mammalian Cells

Target

Transforming growth factor beta-1 proprotein (TGFB1)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

12.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Transforming Growth Factor Beta-1; TGF-Beta-1; Latency-Associated Peptide; LAP; TGFB1; TGFB

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Cross Linked C-Telopeptide Of Type II Collagen (CTXII) ELISA Kit
EKU10756 96 Tests

Rabbit Cross Linked C-Telopeptide Of Type II Collagen (CTXII) ELISA Kit

Sign In for Pricing
View Details
IRK14 Polyclonal Antibody
E44H08098 100 µL

IRK14 Polyclonal Antibody

Sign In for Pricing
View Details
Human Immunodeficiency Virus Type 1 (HIV-1, GP41) (Biotin)
MBS6125165-01 0.1 mL

Human Immunodeficiency Virus Type 1 (HIV-1, GP41) (Biotin)

Sign In for Pricing
View Details
Human Immunodeficiency Virus Type 1 (HIV-1, GP41) (Biotin)
MBS6125165-02 5x 0.1 mL

Human Immunodeficiency Virus Type 1 (HIV-1, GP41) (Biotin)

Sign In for Pricing
View Details
Gastrin Releasing Peptide, human
E-PP-1192-01 1 mg

Gastrin Releasing Peptide, human

Sign In for Pricing
View Details
Gastrin Releasing Peptide, human
E-PP-1192-02 10 mg

Gastrin Releasing Peptide, human

Sign In for Pricing
View Details