Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Macrophage colony-stimulating factor 1 protein (CSF1), partial , Active Protein

Recombinant Human Macrophage colony-stimulating factor 1 protein (CSF1), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Macrophage colony-stimulating factor 1 protein (CSF1) . Accession Number: P09603; CSF1. Expression Region: 33-190aa. Tag Info: Tag-Free. Theoretical MW: 18.4kda. Target Synonyms: CSF-1; MCSF; Lanimostim Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Macrophage colony-stimulating factor 1 protein (CSF1), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P09603; CSF1

Expression Region

33-190aa

Host

E. coli

Target

Macrophage colony-stimulating factor 1 protein (CSF1)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial of Isoform 3

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CSF-1; MCSF; Lanimostim

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (4-Fluorobenzoyl) propionic acid
231325-01 5 g

3- (4-Fluorobenzoyl) propionic acid

Sign In for Pricing
View Details
3- (4-Fluorobenzoyl) propionic acid
231325-02 25 g

3- (4-Fluorobenzoyl) propionic acid

Sign In for Pricing
View Details
3- (4-Fluorobenzoyl) propionic acid
231325-03 100 g

3- (4-Fluorobenzoyl) propionic acid

Sign In for Pricing
View Details
3- (4-Fluorobenzoyl) propionic acid
231325-04 250 g

3- (4-Fluorobenzoyl) propionic acid

Sign In for Pricing
View Details
Nalgene CA MF75 50mm x 0.45um x 1L Bottle Top Filter
FIL8148 12 / PCK

Nalgene CA MF75 50mm x 0.45um x 1L Bottle Top Filter

Sign In for Pricing
View Details
Recombinant Streptomyces avermitilis NADH-quinone oxidoreductase subunit D 1 (nuoD1)
MBS1486509-01 0.02 mg (E-Coli)

Recombinant Streptomyces avermitilis NADH-quinone oxidoreductase subunit D 1 (nuoD1)

Sign In for Pricing
View Details