Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Brain-derived neurotrophic factor (BDNF), Active Protein

Recombinant Human Brain-derived neurotrophic factor (BDNF), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Brain-derived neurotrophic factor (BDNF) . Accession Number: P23560; BDNF. Expression Region: 129-247aa. Tag Info: Tag-Free. Theoretical MW: 13kda. Target Synonyms: Brain-Derived Neurotrophic Factor; BDNF; Abrineurin Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Brain-derived neurotrophic factor (BDNF), Active Protein is a purified Active Recombinant Protein.

Accession Number

P23560; BDNF

Expression Region

129-247aa

Host

E. coli

Target

Brain-derived neurotrophic factor (BDNF)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Neuroscience

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Brain-Derived Neurotrophic Factor; BDNF; Abrineurin

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDS028 (Integrin alpha FG-GAP Repeat Containing 2, MDS028) (PE)
MBS6184063-01 0.1 mL

MDS028 (Integrin alpha FG-GAP Repeat Containing 2, MDS028) (PE)

Sign In for Pricing
View Details
MDS028 (Integrin alpha FG-GAP Repeat Containing 2, MDS028) (PE)
MBS6184063-02 5x 0.1 mL

MDS028 (Integrin alpha FG-GAP Repeat Containing 2, MDS028) (PE)

Sign In for Pricing
View Details
Rabbit Monoclonal Phospho-Tyrosine Antibody (PY2870R)
NBP3-07288-20ug 20 µg

Rabbit Monoclonal Phospho-Tyrosine Antibody (PY2870R)

Sign In for Pricing
View Details
Rabbit anti-Surfactant Protein C Antibody
MBS4511374-01 0.05 mL

Rabbit anti-Surfactant Protein C Antibody

Sign In for Pricing
View Details
Rabbit anti-Surfactant Protein C Antibody
MBS4511374-02 0.1 mL

Rabbit anti-Surfactant Protein C Antibody

Sign In for Pricing
View Details
Rabbit anti-Surfactant Protein C Antibody
MBS4511374-03 5x 0.1 mL

Rabbit anti-Surfactant Protein C Antibody

Sign In for Pricing
View Details