Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Brain-derived neurotrophic factor (BDNF), Active Protein

Recombinant Human Brain-derived neurotrophic factor (BDNF), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Brain-derived neurotrophic factor (BDNF) . Accession Number: P23560; BDNF. Expression Region: 129-247aa. Tag Info: Tag-Free. Theoretical MW: 13kda. Target Synonyms: Brain-Derived Neurotrophic Factor; BDNF; Abrineurin Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Brain-derived neurotrophic factor (BDNF), Active Protein is a purified Active Recombinant Protein.

Accession Number

P23560; BDNF

Expression Region

129-247aa

Host

E. coli

Target

Brain-derived neurotrophic factor (BDNF)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Neuroscience

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Brain-Derived Neurotrophic Factor; BDNF; Abrineurin

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-SPORT6-Gal Plasmid
PVT57775 2 µg

pCMV-SPORT6-Gal Plasmid

Sign In for Pricing
View Details
G protein alpha S (GNAS) Human Gene Knockout Kit (CRISPR)
KN412804 1 Kit

G protein alpha S (GNAS) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Sheep Carbonic Anhydrase I ELISA Kit
MBS735925-01 48 Well

Sheep Carbonic Anhydrase I ELISA Kit

Sign In for Pricing
View Details
Sheep Carbonic Anhydrase I ELISA Kit
MBS735925-02 96 Well

Sheep Carbonic Anhydrase I ELISA Kit

Sign In for Pricing
View Details
Sheep Carbonic Anhydrase I ELISA Kit
MBS735925-03 5x 96 Well

Sheep Carbonic Anhydrase I ELISA Kit

Sign In for Pricing
View Details
Sheep Carbonic Anhydrase I ELISA Kit
MBS735925-04 10x 96 Well

Sheep Carbonic Anhydrase I ELISA Kit

Sign In for Pricing
View Details