Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human IL23A & IL12B Heterodimer Protein , Active Protein

Recombinant Human IL23A & IL12B Heterodimer Protein , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: IL23A & IL12B Heterodimer Protein. Accession Number: Q9NPF7 & P29460; IL-23. Expression Region: 20-189aa & 23-328aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 54.4kda. Target Synonyms: SGRF; IL-23p19; CLMF p40; IL-12 subunit p40; NKSF2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human IL23A & IL12B Heterodimer Protein , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q9NPF7 & P29460; IL-23

Expression Region

20-189aa & 23-328aa

Host

Mammalian Cells

Target

IL23A & IL12B Heterodimer Protein

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Heterodimer

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

54.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

SGRF; IL-23p19; CLMF p40; IL-12 subunit p40; NKSF2

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLS&IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIW STDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C8orf46 Recombinant Protein Antigen
NBP2-57933PEP 100 µL

C8orf46 Recombinant Protein Antigen

Sign In for Pricing
View Details
Human papillomavirus IgG, HPV-IgG ELISA Kit
MBS1611976 96 Well

Human papillomavirus IgG, HPV-IgG ELISA Kit

Sign In for Pricing
View Details
CEBPA Antibody
MBS7126960-01 0.05 mL

CEBPA Antibody

Sign In for Pricing
View Details
CEBPA Antibody
MBS7126960-02 0.1 mL

CEBPA Antibody

Sign In for Pricing
View Details
CEBPA Antibody
MBS7126960-03 5x 0.1 mL

CEBPA Antibody

Sign In for Pricing
View Details
Mouse Monoclonal AK3L1 Antibody (OTI3B1) [mFluor Violet 610 SE]
NBP2-70129MFV610 0.1 mL

Mouse Monoclonal AK3L1 Antibody (OTI3B1) [mFluor Violet 610 SE]

Sign In for Pricing
View Details