Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon alpha-2 (IFNA2), Active Protein

Recombinant Human Interferon alpha-2 (IFNA2), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Interferon alpha-2 (IFNA2) . Accession Number: P01563; IFNA2. Expression Region: 24-188aa. Tag Info: Tag-Free. Theoretical MW: 19.4kda. Target Synonyms: Interferon Alpha-2; IFN-Alpha-2; Interferon Alpha-A; LeIF A; IFNA2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Interferon alpha-2 (IFNA2), Active Protein is a purified Active Recombinant Protein.

Accession Number

P01563; IFNA2

Expression Region

24-188aa

Host

E. coli

Target

Interferon alpha-2 (IFNA2)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Interferon Alpha-2; IFN-Alpha-2; Interferon Alpha-A; LeIF A; IFNA2

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR1H4 Protein Vector (Mouse) (pPM-C-His)
PV206481 500 ng

NR1H4 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Lentiviral human FOXF1 shRNA (UAS) - Lentiviral human FOXF1 shRNA (UAS, GFP) plasmid
GTR15096970 1 Vial

Lentiviral human FOXF1 shRNA (UAS) - Lentiviral human FOXF1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Rabbit anti-MAD1 Antibody, Affinity Purified
MBS3900942-01 0.01 mg

Rabbit anti-MAD1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-MAD1 Antibody, Affinity Purified
MBS3900942-02 0.1 mg

Rabbit anti-MAD1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-MAD1 Antibody, Affinity Purified
MBS3900942-03 5x 0.01 mg

Rabbit anti-MAD1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-MAD1 Antibody, Affinity Purified
MBS3900942-04 5x 0.1 mg

Rabbit anti-MAD1 Antibody, Affinity Purified

Sign In for Pricing
View Details