Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-36 alpha protein (Il36a), Active Protein

Recombinant Mouse Interleukin-36 alpha protein (Il36a), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: Interleukin-36 alpha protein (Il36a) . Accession Number: Q9JLA2; Il36a; Fil1e; Il1e; Il1f6; Il1h1. Expression Region: 8-160aa. Tag Info: Tag-Free. Theoretical MW: 17.1kda. Target Synonyms: FIL1 epsilon; IL-1 epsilon; Interleukin-1 family member 6; IL-1F6; Interleukin-1 homolog 1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Interleukin-36 alpha protein (Il36a), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q9JLA2; Il36a; Fil1e; Il1e; Il1f6; Il1h1

Expression Region

8-160aa

Host

E. coli

Target

Interleukin-36 alpha protein (Il36a)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

FIL1 epsilon; IL-1 epsilon; Interleukin-1 family member 6; IL-1F6; Interleukin-1 homolog 1

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

RAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Angiotensin II Antibody (KAA8) [Alexa Fluor 594] - Chimeric
NBP3-20123AF594 0.1 mL

Rabbit Monoclonal Angiotensin II Antibody (KAA8) [Alexa Fluor 594] - Chimeric

Sign In for Pricing
View Details
Complete PK-15 Cell Medium with Serum and Supplements
C7857C 550 mL

Complete PK-15 Cell Medium with Serum and Supplements

Sign In for Pricing
View Details
DetectX® Cyclic GMP Antibody, 13ML
C237-13ML 13ML

DetectX® Cyclic GMP Antibody, 13ML

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS815157 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Ntn3 Mouse shRNA Lentiviral Particle (Locus ID 18209)
TL514847V 500 µL Each

Ntn3 Mouse shRNA Lentiviral Particle (Locus ID 18209)

Sign In for Pricing
View Details
UQCRQ (Cytochrome b-c1 Complex Subunit 8, Complex III Subunit 8, Complex III Subunit VIII, Ubiquinol-Cytochrome c Reductase Complex 95kD Protein, Ubiquinol-Cytochrome c Reductase Complex Ubiquinone-Binding Protein QP-C, UQCRQ) (AP) discontinued
302831-AP 200 µL

UQCRQ (Cytochrome b-c1 Complex Subunit 8, Complex III Subunit 8, Complex III Subunit VIII, Ubiquinol-Cytochrome c Reductase Complex 95kD Protein, Ubiquinol-Cytochrome c Reductase Complex Ubiquinone-Binding Protein QP-C, UQCRQ) (AP) discontinued

Sign In for Pricing
View Details