Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-36 alpha protein (Il36a), Active Protein

Recombinant Mouse Interleukin-36 alpha protein (Il36a), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: Interleukin-36 alpha protein (Il36a) . Accession Number: Q9JLA2; Il36a; Fil1e; Il1e; Il1f6; Il1h1. Expression Region: 8-160aa. Tag Info: Tag-Free. Theoretical MW: 17.1kda. Target Synonyms: FIL1 epsilon; IL-1 epsilon; Interleukin-1 family member 6; IL-1F6; Interleukin-1 homolog 1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Interleukin-36 alpha protein (Il36a), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q9JLA2; Il36a; Fil1e; Il1e; Il1f6; Il1h1

Expression Region

8-160aa

Host

E. coli

Target

Interleukin-36 alpha protein (Il36a)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

FIL1 epsilon; IL-1 epsilon; Interleukin-1 family member 6; IL-1F6; Interleukin-1 homolog 1

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

RAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSUN4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1458206 1.0 µg DNA

NSUN4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Active Recombinant Human Nerve Growth Factor (beta polypeptide)
NGF-573H 500 µg

Active Recombinant Human Nerve Growth Factor (beta polypeptide)

Sign In for Pricing
View Details
Tenascin (TN, Tenascin-C, TNC, TN-C, 150-225, Cytotactin, Glioma-associated Extracellular Matrix Antigen, GMEM, GP 150-225, Hexabrachion, HXB, JI, MGC167029, Myotendinous Antigen, Neuronectin) (MaxLight 490)
MBS6203702-01 0.1 mL

Tenascin (TN, Tenascin-C, TNC, TN-C, 150-225, Cytotactin, Glioma-associated Extracellular Matrix Antigen, GMEM, GP 150-225, Hexabrachion, HXB, JI, MGC167029, Myotendinous Antigen, Neuronectin) (MaxLight 490)

Sign In for Pricing
View Details
Tenascin (TN, Tenascin-C, TNC, TN-C, 150-225, Cytotactin, Glioma-associated Extracellular Matrix Antigen, GMEM, GP 150-225, Hexabrachion, HXB, JI, MGC167029, Myotendinous Antigen, Neuronectin) (MaxLight 490)
MBS6203702-02 5x 0.1 mL

Tenascin (TN, Tenascin-C, TNC, TN-C, 150-225, Cytotactin, Glioma-associated Extracellular Matrix Antigen, GMEM, GP 150-225, Hexabrachion, HXB, JI, MGC167029, Myotendinous Antigen, Neuronectin) (MaxLight 490)

Sign In for Pricing
View Details
BRCA2 (NM_000059) Human Mutant ORF Clone
RC400514 10 µg

BRCA2 (NM_000059) Human Mutant ORF Clone

Sign In for Pricing
View Details
FAM163A, ID (FAM163A, C1orf76, NDSP, Protein FAM163A, Cebelin, Neuroblastoma-derived secretory protein) (FITC)
MBS6297815-01 0.2 mL

FAM163A, ID (FAM163A, C1orf76, NDSP, Protein FAM163A, Cebelin, Neuroblastoma-derived secretory protein) (FITC)

Sign In for Pricing
View Details