Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon alpha-1/13 protein (IFNA1), Active Protein

Recombinant Human Interferon alpha-1/13 protein (IFNA1), Active Protein is a purified Active Recombinant Protein. Purity: >96% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Interferon alpha-1/13 protein (IFNA1) . Accession Number: P01562; IFNA1; ; IFNA13. Expression Region: 24-189aa. Tag Info: Tag-Free. Theoretical MW: 19.5kda. Target Synonyms: IFN-alpha-1/13; LeIF D Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Interferon alpha-1/13 protein (IFNA1), Active Protein is a purified Active Recombinant Protein.

Accession Number

P01562; IFNA1; ; IFNA13

Expression Region

24-189aa

Host

E. coli

Target

Interferon alpha-1/13 protein (IFNA1)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>96% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IFN-alpha-1/13; LeIF D

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

M+CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNVDSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat GCGR Protein, His (Fc)-Avi-tagged
GCGR-2144R 50 µg

Recombinant Rat GCGR Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis Adenylosuccinate synthetase (purA)
MBS1289739-01 0.02 mg (E-Coli)

Recombinant Staphylococcus epidermidis Adenylosuccinate synthetase (purA)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis Adenylosuccinate synthetase (purA)
MBS1289739-02 0.02 mg (Yeast)

Recombinant Staphylococcus epidermidis Adenylosuccinate synthetase (purA)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis Adenylosuccinate synthetase (purA)
MBS1289739-03 0.1 mg (E-Coli)

Recombinant Staphylococcus epidermidis Adenylosuccinate synthetase (purA)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis Adenylosuccinate synthetase (purA)
MBS1289739-04 0.1 mg (Yeast)

Recombinant Staphylococcus epidermidis Adenylosuccinate synthetase (purA)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis Adenylosuccinate synthetase (purA)
MBS1289739-05 0.02 mg (Baculovirus)

Recombinant Staphylococcus epidermidis Adenylosuccinate synthetase (purA)

Sign In for Pricing
View Details