Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin-like growth factor II protein (IGF2), Active Protein

Recombinant Human Insulin-like growth factor II protein (IGF2), Active Protein is a purified Active Recombinant Protein. Purity: >98% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Insulin-like growth factor II protein (IGF2) . Accession Number: P01344; IGF2; PP1446. Expression Region: 25-91aa. Tag Info: Tag-Free. Theoretical MW: 7.5kda. Target Synonyms: IGF-II; T3M-11-derived growth factor Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Insulin-like growth factor II protein (IGF2), Active Protein is a purified Active Recombinant Protein.

Accession Number

P01344; IGF2; PP1446

Expression Region

25-91aa

Host

E. coli

Target

Insulin-like growth factor II protein (IGF2)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>98% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

7.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IGF-II; T3M-11-derived growth factor

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Forkhead Box Protein M1 (FOXM1) Protein
abx165919-01 10 µg

Rat Forkhead Box Protein M1 (FOXM1) Protein

Sign In for Pricing
View Details
Rat Forkhead Box Protein M1 (FOXM1) Protein
abx165919-02 50 µg

Rat Forkhead Box Protein M1 (FOXM1) Protein

Sign In for Pricing
View Details
Rat Forkhead Box Protein M1 (FOXM1) Protein
abx165919-03 100 µg

Rat Forkhead Box Protein M1 (FOXM1) Protein

Sign In for Pricing
View Details
Rat Forkhead Box Protein M1 (FOXM1) Protein
abx165919-04 200 µg

Rat Forkhead Box Protein M1 (FOXM1) Protein

Sign In for Pricing
View Details
Rat Forkhead Box Protein M1 (FOXM1) Protein
abx165919-05 500 µg

Rat Forkhead Box Protein M1 (FOXM1) Protein

Sign In for Pricing
View Details
C8 (C8G) Human siRNA Oligo Duplex (Locus ID 733)
SR300512 1 Kit

C8 (C8G) Human siRNA Oligo Duplex (Locus ID 733)

Sign In for Pricing
View Details