Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 21 protein (FGF21), Active Protein

Recombinant Human Fibroblast growth factor 21 protein (FGF21), Active Protein is a purified Active Recombinant Protein. Purity: >96% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Fibroblast growth factor 21 protein (FGF21) . Accession Number: Q9NSA1; FGF21; UNQ3115/PRO10196. Expression Region: 29-209aa. Tag Info: Tag-Free. Theoretical MW: 19.4kda. Target Synonyms: FGF-21 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Fibroblast growth factor 21 protein (FGF21), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q9NSA1; FGF21; UNQ3115/PRO10196

Expression Region

29-209aa

Host

E. coli

Target

Fibroblast growth factor 21 protein (FGF21)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>96% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

FGF-21

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Zygosaccharomyces rouxii Maintenance of telomere capping protein 6 (MTC6)
MBS1250192-01 0.5 mg (E-Coli)

Recombinant Zygosaccharomyces rouxii Maintenance of telomere capping protein 6 (MTC6)

Sign In for Pricing
View Details
Recombinant Zygosaccharomyces rouxii Maintenance of telomere capping protein 6 (MTC6)
MBS1250192-02 0.05 mg (Baculovirus)

Recombinant Zygosaccharomyces rouxii Maintenance of telomere capping protein 6 (MTC6)

Sign In for Pricing
View Details
Recombinant Zygosaccharomyces rouxii Maintenance of telomere capping protein 6 (MTC6)
MBS1250192-03 0.5 mg (Yeast)

Recombinant Zygosaccharomyces rouxii Maintenance of telomere capping protein 6 (MTC6)

Sign In for Pricing
View Details
Recombinant Zygosaccharomyces rouxii Maintenance of telomere capping protein 6 (MTC6)
MBS1250192-04 0.05 mg (Mammalian-Cell)

Recombinant Zygosaccharomyces rouxii Maintenance of telomere capping protein 6 (MTC6)

Sign In for Pricing
View Details
Recombinant Zygosaccharomyces rouxii Maintenance of telomere capping protein 6 (MTC6)
MBS1250192-05 1 mg (E-Coli)

Recombinant Zygosaccharomyces rouxii Maintenance of telomere capping protein 6 (MTC6)

Sign In for Pricing
View Details
Recombinant Zygosaccharomyces rouxii Maintenance of telomere capping protein 6 (MTC6)
MBS1250192-06 0.1 mg (Baculovirus)

Recombinant Zygosaccharomyces rouxii Maintenance of telomere capping protein 6 (MTC6)

Sign In for Pricing
View Details