Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukemia inhibitory factor protein (LIF), Active Protein

Recombinant Human Leukemia inhibitory factor protein (LIF), Active Protein is a purified Active Recombinant Protein. Purity: >98% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Leukemia inhibitory factor protein (LIF) . Accession Number: P15018; LIF; HILDA. Expression Region: 23-202aa. Tag Info: Tag-Free. Theoretical MW: 19.7kda. Target Synonyms: LIF; D factor; Melanoma-derived LPL inhibitor; MLPLI; Emfilermin Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Leukemia inhibitory factor protein (LIF), Active Protein is a purified Active Recombinant Protein.

Accession Number

P15018; LIF; HILDA

Expression Region

23-202aa

Host

E. coli

Target

Leukemia inhibitory factor protein (LIF)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>98% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

LIF; D factor; Melanoma-derived LPL inhibitor; MLPLI; Emfilermin

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase 8 (CASP8) Human Gene Knockout Kit (CRISPR)
KN216248LP 1 Kit

Caspase 8 (CASP8) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZASC1 shRNA (m) Lentiviral Particles
sc-155431-V 200 µL

ZASC1 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
KLF15 Polyclonal Antibody
MBS8568152-01 0.1 mL

KLF15 Polyclonal Antibody

Sign In for Pricing
View Details
KLF15 Polyclonal Antibody
MBS8568152-02 0.1 mL (AF405L)

KLF15 Polyclonal Antibody

Sign In for Pricing
View Details
KLF15 Polyclonal Antibody
MBS8568152-03 0.1 mL (AF405S)

KLF15 Polyclonal Antibody

Sign In for Pricing
View Details
KLF15 Polyclonal Antibody
MBS8568152-04 0.1 mL (AF610)

KLF15 Polyclonal Antibody

Sign In for Pricing
View Details