Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-17B protein (IL17B), Active Protein

Recombinant Human Interleukin-17B protein (IL17B), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Interleukin-17B protein (IL17B) . Accession Number: Q9UHF5; IL17B; IL20; NIRF; ZCYTO7; UNQ516/PRO1031. Expression Region: 21-180aa. Tag Info: Tag-Free. Theoretical MW: 18.3kda. Target Synonyms: IL-17B; Interleukin-20; IL-20; Neuronal interleukin-17-related factor Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Interleukin-17B protein (IL17B), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q9UHF5; IL17B; IL20; NIRF; ZCYTO7; UNQ516/PRO1031

Expression Region

21-180aa

Host

E. coli

Target

Interleukin-17B protein (IL17B)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IL-17B; Interleukin-20; IL-20; Neuronal interleukin-17-related factor

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

M+QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bis(triphenylphosphine)nickel(II) Dichloride
TRC-B588700-10G 10 g

Bis(triphenylphosphine)nickel(II) Dichloride

Sign In for Pricing
View Details
CX3CL1 Antibody (Center)
E45R33532G-1 100 µL

CX3CL1 Antibody (Center)

Sign In for Pricing
View Details
RPL39P31 CRISPR Knock Out 293T Cell Line (Human)
41671141 1x 10^6 Cells / 1.0 mL

RPL39P31 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Anti-Zebrafish CSNK2B Antibody Picoband® Fluoro488 Conjugated
AZQ91398-Fluoro488 100 µg/Vial

Anti-Zebrafish CSNK2B Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
ZC3H12D Recombinant Protein (Rat)
RP237932 100 µg

ZC3H12D Recombinant Protein (Rat)

Sign In for Pricing
View Details
[KO Validated] DNA Ligase IV Rabbit pAb
E45R24179N-50 50 µL

[KO Validated] DNA Ligase IV Rabbit pAb

Sign In for Pricing
View Details