Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-17B protein (IL17B), Active Protein

Recombinant Human Interleukin-17B protein (IL17B), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Interleukin-17B protein (IL17B) . Accession Number: Q9UHF5; IL17B; IL20; NIRF; ZCYTO7; UNQ516/PRO1031. Expression Region: 21-180aa. Tag Info: Tag-Free. Theoretical MW: 18.3kda. Target Synonyms: IL-17B; Interleukin-20; IL-20; Neuronal interleukin-17-related factor Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Interleukin-17B protein (IL17B), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q9UHF5; IL17B; IL20; NIRF; ZCYTO7; UNQ516/PRO1031

Expression Region

21-180aa

Host

E. coli

Target

Interleukin-17B protein (IL17B)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IL-17B; Interleukin-20; IL-20; Neuronal interleukin-17-related factor

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

M+QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS4 Rabbit Polyclonal Antibody (PE)
orb498004 100 µL

RGS4 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
ISO20560PM-220X210-TETRAHYDROFURAAN Pipe Markers for Other Liquids
316939 1 Pack (1 Marker (s) x 1 Card)

ISO20560PM-220X210-TETRAHYDROFURAAN Pipe Markers for Other Liquids

Sign In for Pricing
View Details
Human Calcium Channel, Voltage Dependent, L-Type, Alpha 1F Subunit (CACNa1F) ELISA Kit
YP-W15556-01 48 Tests

Human Calcium Channel, Voltage Dependent, L-Type, Alpha 1F Subunit (CACNa1F) ELISA Kit

Sign In for Pricing
View Details
Human Calcium Channel, Voltage Dependent, L-Type, Alpha 1F Subunit (CACNa1F) ELISA Kit
YP-W15556-02 96 Tests

Human Calcium Channel, Voltage Dependent, L-Type, Alpha 1F Subunit (CACNa1F) ELISA Kit

Sign In for Pricing
View Details
Anti-APG5L/ATG5  (2G8)
YF-MA16874 100 ug

Anti-APG5L/ATG5 (2G8)

Sign In for Pricing
View Details
Rabbit Monoclonal Reg1B Antibody (103) [PerCP]
NBP2-89940PCP 0.1 mL

Rabbit Monoclonal Reg1B Antibody (103) [PerCP]

Sign In for Pricing
View Details