Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thymosin beta-4 (TMSB4X), Active Protein

Recombinant Human Thymosin beta-4 (TMSB4X), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Thymosin beta-4 (TMSB4X) . Accession Number: P62328; TMSB4X; TB4X; THYB4; TMSB4. Expression Region: 2-44aa. Tag Info: Tag-Free. Theoretical MW: 4.9kda. Target Synonyms: T beta-4 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Thymosin beta-4 (TMSB4X), Active Protein is a purified Active Recombinant Protein.

Accession Number

P62328; TMSB4X; TB4X; THYB4; TMSB4

Expression Region

2-44aa

Host

E. coli

Target

Thymosin beta-4 (TMSB4X)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Signal Transduction

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

4.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

T beta-4

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Pleura
CS705907 5x 5 µm

Tissue FFPE Sections, Pleura

Sign In for Pricing
View Details
KPNB1 (NM_002265) Human Over-expression Lysate
LY419417 100 µg

KPNB1 (NM_002265) Human Over-expression Lysate

Sign In for Pricing
View Details
Slc36a1 Mouse Gene Knockout Kit (CRISPR)
KN516081 1 Kit

Slc36a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Gabra2 activation kit by CRISPRa
GA201514 1 Kit

Mouse Gabra2 activation kit by CRISPRa

Sign In for Pricing
View Details
Apolipoprotein L 1 (APOL1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D9]
TA812037BM 100 µL

Apolipoprotein L 1 (APOL1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D9]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Stomach
CB530870 1 Block

Frozen Tissue Blocks, Stomach

Sign In for Pricing
View Details