Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhesus Macaque Interferon gamma protein (IFNG), Active Protein

Recombinant Rhesus Macaque Interferon gamma protein (IFNG), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Macaca mulatta (Rhesus macaque) . Target Name: Interferon gamma protein (IFNG) . Accession Number: P63310; IFNG. Expression Region: 24-165aa. Tag Info: Tag-Free. Theoretical MW: 16.8kda. Target Synonyms: IFN-gamma Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rhesus Macaque Interferon gamma protein (IFNG), Active Protein is a purified Active Recombinant Protein.

Accession Number

P63310; IFNG

Expression Region

24-165aa

Host

E. coli

Target

Interferon gamma protein (IFNG)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IFN-gamma

Species

Macaca mulatta (Rhesus macaque)

Protein Name

Active Recombinant Protein

AA Sequence

QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Small integral membrane protein 38 (SIM38), partial
orb3009045-01 20 µg

Recombinant Human Small integral membrane protein 38 (SIM38), partial

Sign In for Pricing
View Details
Recombinant Human Small integral membrane protein 38 (SIM38), partial
orb3009045-02 100 µg

Recombinant Human Small integral membrane protein 38 (SIM38), partial

Sign In for Pricing
View Details
Recombinant Human Small integral membrane protein 38 (SIM38), partial
orb3009045-03 1 mg

Recombinant Human Small integral membrane protein 38 (SIM38), partial

Sign In for Pricing
View Details
Pnrc1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
37127114 3x 1.0 µg

Pnrc1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Myh4 (NM_010855) Mouse Recombinant Protein
TP526919 20 µg

Myh4 (NM_010855) Mouse Recombinant Protein

Sign In for Pricing
View Details
Bung Red Rubber 2 Hole No 49
STO5252 5 / PCK

Bung Red Rubber 2 Hole No 49

Sign In for Pricing
View Details