Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhesus Macaque Interleukin-1 beta protein (IL1B), Active Protein

Recombinant Rhesus Macaque Interleukin-1 beta protein (IL1B), Active Protein is a purified Active Recombinant Protein. Purity: >98% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Macaca mulatta (Rhesus macaque) . Target Name: Interleukin-1 beta protein (IL1B) . Accession Number: P48090; IL1B. Expression Region: 117-269aa. Tag Info: Tag-Free. Theoretical MW: 17.3kda. Target Synonyms: IL-1 beta Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rhesus Macaque Interleukin-1 beta protein (IL1B), Active Protein is a purified Active Recombinant Protein.

Accession Number

P48090; IL1B

Expression Region

117-269aa

Host

E. coli

Target

Interleukin-1 beta protein (IL1B)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>98% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IL-1 beta

Species

Macaca mulatta (Rhesus macaque)

Protein Name

Active Recombinant Protein

AA Sequence

APVRSLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFVQGEESNDKIPVALGLKAKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTRGGQDITDFTMQFVSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Stromal Cell Derived Factor 1Beta ELISA Kit
MBS011023-01 48 Well

Bovine Stromal Cell Derived Factor 1Beta ELISA Kit

Sign In for Pricing
View Details
Bovine Stromal Cell Derived Factor 1Beta ELISA Kit
MBS011023-02 96 Well

Bovine Stromal Cell Derived Factor 1Beta ELISA Kit

Sign In for Pricing
View Details
Bovine Stromal Cell Derived Factor 1Beta ELISA Kit
MBS011023-03 5x 96 Well

Bovine Stromal Cell Derived Factor 1Beta ELISA Kit

Sign In for Pricing
View Details
Bovine Stromal Cell Derived Factor 1Beta ELISA Kit
MBS011023-04 10x 96 Well

Bovine Stromal Cell Derived Factor 1Beta ELISA Kit

Sign In for Pricing
View Details
IgA1, Lambda, Myeloma, Human discontinued
I1890-71-01 1 mg

IgA1, Lambda, Myeloma, Human discontinued

Sign In for Pricing
View Details
IgA1, Lambda, Myeloma, Human discontinued
I1890-71-02 5 mg

IgA1, Lambda, Myeloma, Human discontinued

Sign In for Pricing
View Details