Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 1 protein (DEFB1), Active Protein

Recombinant Human Beta-defensin 1 protein (DEFB1), Active Protein is a purified Active Recombinant Protein. Purity: >98% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Beta-defensin 1 protein (DEFB1) . Accession Number: P60022; DEFB1; BD1; HBD1. Expression Region: 22-68aa. Tag Info: Tag-Free. Theoretical MW: 5.1kda. Target Synonyms: BD-1; Defensin; beta 1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Beta-defensin 1 protein (DEFB1), Active Protein is a purified Active Recombinant Protein.

Accession Number

P60022; DEFB1; BD1; HBD1

Expression Region

22-68aa

Host

E. coli

Target

Beta-defensin 1 protein (DEFB1)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Microbiology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>98% by SDS-PAGE

Activity

Biologically Active

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

5.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

BD-1; Defensin; beta 1

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMARCD2 Antibody
A64223-50UG 50 µg

SMARCD2 Antibody

Sign In for Pricing
View Details
Recombinant Olimarabidopsis pumila NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic
MBS7023059-01 0.02 mg

Recombinant Olimarabidopsis pumila NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic

Sign In for Pricing
View Details
Recombinant Olimarabidopsis pumila NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic
MBS7023059-02 0.1 mg

Recombinant Olimarabidopsis pumila NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic

Sign In for Pricing
View Details
Recombinant Olimarabidopsis pumila NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic
MBS7023059-03 5x 0.1 mg

Recombinant Olimarabidopsis pumila NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic

Sign In for Pricing
View Details
6-Methoxybenzothiazole-2-carboxylic acid
FM35221-01 250 mg

6-Methoxybenzothiazole-2-carboxylic acid

Sign In for Pricing
View Details
6-Methoxybenzothiazole-2-carboxylic acid
FM35221-02 500 mg

6-Methoxybenzothiazole-2-carboxylic acid

Sign In for Pricing
View Details