Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 1 protein (DEFB1), Active Protein

Recombinant Human Beta-defensin 1 protein (DEFB1), Active Protein is a purified Active Recombinant Protein. Purity: >98% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Beta-defensin 1 protein (DEFB1) . Accession Number: P60022; DEFB1; BD1; HBD1. Expression Region: 22-68aa. Tag Info: Tag-Free. Theoretical MW: 5.1kda. Target Synonyms: BD-1; Defensin; beta 1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Beta-defensin 1 protein (DEFB1), Active Protein is a purified Active Recombinant Protein.

Accession Number

P60022; DEFB1; BD1; HBD1

Expression Region

22-68aa

Host

E. coli

Target

Beta-defensin 1 protein (DEFB1)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Microbiology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>98% by SDS-PAGE

Activity

Biologically Active

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

5.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

BD-1; Defensin; beta 1

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Leucine Rich Alpha-2-Glycoprotein 1 (LRG1)
RPU58604-01 50 µg

Recombinant Mouse Leucine Rich Alpha-2-Glycoprotein 1 (LRG1)

Sign In for Pricing
View Details
Recombinant Mouse Leucine Rich Alpha-2-Glycoprotein 1 (LRG1)
RPU58604-02 100 µg

Recombinant Mouse Leucine Rich Alpha-2-Glycoprotein 1 (LRG1)

Sign In for Pricing
View Details
Recombinant Mouse Leucine Rich Alpha-2-Glycoprotein 1 (LRG1)
RPU58604-03 1 mg

Recombinant Mouse Leucine Rich Alpha-2-Glycoprotein 1 (LRG1)

Sign In for Pricing
View Details
(±) -Abscisic acid Plant Culture Tested
PCT0815-500MG 500 mg

(±) -Abscisic acid Plant Culture Tested

Sign In for Pricing
View Details
SP100 (Nuclear Autoantigen Sp-100, Lysp100b, Nuclear Dot-associated Sp100 Protein, Speckled 100kD) (MaxLight 550)
MBS6500355-01 0.1 mL

SP100 (Nuclear Autoantigen Sp-100, Lysp100b, Nuclear Dot-associated Sp100 Protein, Speckled 100kD) (MaxLight 550)

Sign In for Pricing
View Details
SP100 (Nuclear Autoantigen Sp-100, Lysp100b, Nuclear Dot-associated Sp100 Protein, Speckled 100kD) (MaxLight 550)
MBS6500355-02 5x 0.1 mL

SP100 (Nuclear Autoantigen Sp-100, Lysp100b, Nuclear Dot-associated Sp100 Protein, Speckled 100kD) (MaxLight 550)

Sign In for Pricing
View Details