Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Midkine protein (MDK), Active Protein

Recombinant Human Midkine protein (MDK), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Midkine protein (MDK) . Accession Number: P21741; MDK; MK1; NEGF2. Expression Region: 21-143aa. Tag Info: Tag-Free. Theoretical MW: 13.4kda. Target Synonyms: MK; ARAP; Midgestation and kidney protein; Neurite outgrowth-promoting factor 2; Neurite outgrowth-promoting protein Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Midkine protein (MDK), Active Protein is a purified Active Recombinant Protein.

Accession Number

P21741; MDK; MK1; NEGF2

Expression Region

21-143aa

Host

E. coli

Target

Midkine protein (MDK)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Neuroscience

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

MK; ARAP; Midgestation and kidney protein; Neurite outgrowth-promoting factor 2; Neurite outgrowth-promoting protein

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Pf4 Pre-designed siRNA Set B
SI210331B 1 Each

Rat Pf4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Canine_CTLA4 CHO-K1 Cell Line
ABC-X0522F 1 Vial

Canine_CTLA4 CHO-K1 Cell Line

Sign In for Pricing
View Details
GLDC Antibody, HRP conjugated
A50698-100UG 100 µg

GLDC Antibody, HRP conjugated

Sign In for Pricing
View Details
Hsa-miR-4327 antagomir
HY-RI01011A-01 5 nmol

Hsa-miR-4327 antagomir

Sign In for Pricing
View Details
Hsa-miR-4327 antagomir
HY-RI01011A-02 20 nmol

Hsa-miR-4327 antagomir

Sign In for Pricing
View Details
DQX1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-8293R-BF594 100 µL

DQX1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details