Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Midkine protein (MDK), Active Protein

Recombinant Human Midkine protein (MDK), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Midkine protein (MDK) . Accession Number: P21741; MDK; MK1; NEGF2. Expression Region: 21-143aa. Tag Info: Tag-Free. Theoretical MW: 13.4kda. Target Synonyms: MK; ARAP; Midgestation and kidney protein; Neurite outgrowth-promoting factor 2; Neurite outgrowth-promoting protein Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Midkine protein (MDK), Active Protein is a purified Active Recombinant Protein.

Accession Number

P21741; MDK; MK1; NEGF2

Expression Region

21-143aa

Host

E. coli

Target

Midkine protein (MDK)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Neuroscience

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

MK; ARAP; Midgestation and kidney protein; Neurite outgrowth-promoting factor 2; Neurite outgrowth-promoting protein

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMPK alpha-1 Mouse Monoclonal Antibody (BF680)
orb1581970 100 µL

AMPK alpha-1 Mouse Monoclonal Antibody (BF680)

Sign In for Pricing
View Details
Anti-Human TACR1 Polyclonal Antibody
PHD66001 100 μg

Anti-Human TACR1 Polyclonal Antibody

Sign In for Pricing
View Details
KIR3DS1, CT (Killer Cell Immunoglobulin-like Receptor 3DS1, Killer Cell (Ig)-like Receptor 3DS1, CD158E2, KIR-123FM, KIR-G1, MGC119726, MGC119728, MGC125316, MHC Class I NK Cell Receptor, Natural Killer-Associated Transcript 10, NKAT10, NKAT-10)
MBS626991-01 0.2 mL

KIR3DS1, CT (Killer Cell Immunoglobulin-like Receptor 3DS1, Killer Cell (Ig)-like Receptor 3DS1, CD158E2, KIR-123FM, KIR-G1, MGC119726, MGC119728, MGC125316, MHC Class I NK Cell Receptor, Natural Killer-Associated Transcript 10, NKAT10, NKAT-10)

Sign In for Pricing
View Details
KIR3DS1, CT (Killer Cell Immunoglobulin-like Receptor 3DS1, Killer Cell (Ig)-like Receptor 3DS1, CD158E2, KIR-123FM, KIR-G1, MGC119726, MGC119728, MGC125316, MHC Class I NK Cell Receptor, Natural Killer-Associated Transcript 10, NKAT10, NKAT-10)
MBS626991-02 5x 0.2 mL

KIR3DS1, CT (Killer Cell Immunoglobulin-like Receptor 3DS1, Killer Cell (Ig)-like Receptor 3DS1, CD158E2, KIR-123FM, KIR-G1, MGC119726, MGC119728, MGC125316, MHC Class I NK Cell Receptor, Natural Killer-Associated Transcript 10, NKAT10, NKAT-10)

Sign In for Pricing
View Details
Ataxin-10 (C-3) PE
sc-271233 PE 200 µg/mL

Ataxin-10 (C-3) PE

Sign In for Pricing
View Details
PF-5274857
C08849 5 mg

PF-5274857

Sign In for Pricing
View Details