Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-15 & Interleukin-15 receptor subunit alpha (IL15 & IL15RA), partial , Active Protein

Recombinant Human Interleukin-15 & Interleukin-15 receptor subunit alpha (IL15 & IL15RA), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Interleukin-15 & Interleukin-15 receptor subunit alpha (IL15 & IL15RA) . Accession Number: Q13261 & P40933; IL15 & IL15RA. Expression Region: 31-96aa & 49-162aa (N120D) . Tag Info: C-terminal Fc-tagged. Theoretical MW: 46.9kda. Target Synonyms: IL15RA&IL15; Interleukin-15; IL-15; IL15; IL-15 receptor subunit alpha; IL-15RA; IL-15R-alpha; interleukin-15 receptor subunit alpha Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Interleukin-15 & Interleukin-15 receptor subunit alpha (IL15 & IL15RA), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q13261 & P40933; IL15 & IL15RA

Expression Region

31-96aa & 49-162aa (N120D)

Host

Mammalian Cells

Target

Interleukin-15 & Interleukin-15 receptor subunit alpha (IL15 & IL15RA)

Conjugation

Unconjugated

Tag

C-Terminal Fc-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Heterodimer

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IL15RA&IL15; Interleukin-15; IL-15; IL15; IL-15 receptor subunit alpha; IL-15RA; IL-15R-alpha; interleukin-15 receptor subunit alpha

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRD & NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANDSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wnt3 ORF Vector (Rat) (pORF)
50450016 1.0 µg DNA

Wnt3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Anti-PSD-93/Chapsyn-110 Antibody (N18/30)
MBS1571580-01 0.1 mg

Anti-PSD-93/Chapsyn-110 Antibody (N18/30)

Sign In for Pricing
View Details
Anti-PSD-93/Chapsyn-110 Antibody (N18/30)
MBS1571580-02 1 mg

Anti-PSD-93/Chapsyn-110 Antibody (N18/30)

Sign In for Pricing
View Details
Anti-PSD-93/Chapsyn-110 Antibody (N18/30)
MBS1571580-03 5x 1 mg

Anti-PSD-93/Chapsyn-110 Antibody (N18/30)

Sign In for Pricing
View Details
Lentiviral human SEC23A sgRNA gene knockout kit - Lentiviral human SEC23A sgRNA gene knockout kit (plasmid)
GTR15399806 1 Vial

Lentiviral human SEC23A sgRNA gene knockout kit - Lentiviral human SEC23A sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O7:K1 (strain IAI39/ExPEC) NHAB Polyclonal Antibody
MBS7174240 Inquire

Rabbit anti-Escherichia coli O7:K1 (strain IAI39/ExPEC) NHAB Polyclonal Antibody

Sign In for Pricing
View Details