Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-15 & Interleukin-15 receptor subunit alpha (IL15 & IL15RA), partial , Active Protein

Recombinant Human Interleukin-15 & Interleukin-15 receptor subunit alpha (IL15 & IL15RA), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Interleukin-15 & Interleukin-15 receptor subunit alpha (IL15 & IL15RA) . Accession Number: Q13261 & P40933; IL15 & IL15RA. Expression Region: 31-96aa & 49-162aa (N120D) . Tag Info: C-terminal Fc-tagged. Theoretical MW: 46.9kda. Target Synonyms: IL15RA&IL15; Interleukin-15; IL-15; IL15; IL-15 receptor subunit alpha; IL-15RA; IL-15R-alpha; interleukin-15 receptor subunit alpha Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Interleukin-15 & Interleukin-15 receptor subunit alpha (IL15 & IL15RA), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q13261 & P40933; IL15 & IL15RA

Expression Region

31-96aa & 49-162aa (N120D)

Host

Mammalian Cells

Target

Interleukin-15 & Interleukin-15 receptor subunit alpha (IL15 & IL15RA)

Conjugation

Unconjugated

Tag

C-Terminal Fc-Tagged

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Heterodimer

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IL15RA&IL15; Interleukin-15; IL-15; IL15; IL-15 receptor subunit alpha; IL-15RA; IL-15R-alpha; interleukin-15 receptor subunit alpha

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRD & NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANDSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal C6orf226 Antibody [Alexa Fluor 405]
NBP2-98055AF405 0.1 mL

Rabbit Polyclonal C6orf226 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
pCMV-SPORT6.ccdb-Aldoc Plasmid
PVT40831 2 µg

pCMV-SPORT6.ccdb-Aldoc Plasmid

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) DEAD Polyclonal Antibody
MBS7163105 Inquire

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) DEAD Polyclonal Antibody

Sign In for Pricing
View Details
SUPT5H Rabbit Monoclonal Antibody
AMRe84626-01 1 Each

SUPT5H Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SUPT5H Rabbit Monoclonal Antibody
AMRe84626-02 50 µL

SUPT5H Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SUPT5H Rabbit Monoclonal Antibody
AMRe84626-03 100 µL

SUPT5H Rabbit Monoclonal Antibody

Sign In for Pricing
View Details