Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor ligand superfamily member 15 protein (TNFSF15), partial , Active Protein

Recombinant Human Tumor necrosis factor ligand superfamily member 15 protein (TNFSF15), partial , Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Tumor necrosis factor ligand superfamily member 15 protein (TNFSF15) . Accession Number: O95150; TNFSF15. Expression Region: 72-251aa. Tag Info: Tag-Free. Theoretical MW: 20.5kda. Target Synonyms: TNF ligand-related molecule 1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Tumor necrosis factor ligand superfamily member 15 protein (TNFSF15), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

O95150; TNFSF15

Expression Region

72-251aa

Host

E. coli

Target

Tumor necrosis factor ligand superfamily member 15 protein (TNFSF15)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

TNF ligand-related molecule 1

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIA CRISPR/Cas9 KO Plasmid (h)
sc-404978 20 µg

MIA CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
RPL21P44 CRISPR All-in-one AAV vector set (with saCas9)(Human)
41047151 3x 1.0 µg DNA

RPL21P44 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
2-(Diethylcarbamoyl)pyridine-4-boronic acid pinacol ester
MBS9025204-01 1 g

2-(Diethylcarbamoyl)pyridine-4-boronic acid pinacol ester

Sign In for Pricing
View Details
2-(Diethylcarbamoyl)pyridine-4-boronic acid pinacol ester
MBS9025204-02 5x 1 g

2-(Diethylcarbamoyl)pyridine-4-boronic acid pinacol ester

Sign In for Pricing
View Details
Lentiviral human MRPL53 shRNA (UAS) - Lentiviral human MRPL53 shRNA (UAS, GFP) (100)
GTR15352728 1 Vial

Lentiviral human MRPL53 shRNA (UAS) - Lentiviral human MRPL53 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Recombinant Mouse Trace amine-associated receptor 8a (Taar8a)
MBS7030819-01 0.02 mg

Recombinant Mouse Trace amine-associated receptor 8a (Taar8a)

Sign In for Pricing
View Details