Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Vascular endothelial growth factor A (VEGFA)

Recombinant Rabbit Vascular endothelial growth factor A (VEGFA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rabbit (Oryctolagus cuniculus) . Target Name: VEGFA. Accession Number: XP_002714743.1. Expression Region: 51~511aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 65.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rabbit Vascular endothelial growth factor A (VEGFA) is a purified Recombinant Protein.

Accession Number

XP_002714743.1

Expression Region

51~511aa

Host

E. coli

Target

VEGFA

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

65.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Rabbit (Oryctolagus cuniculus)

Protein Name

Recombinant Protein

AA Sequence

YLWLLHAPLLHVSLDSLVAAFSVVFEVLPSSLDIPGSKKEEQASTQLGGVEEEHEASGVVTRQLAFVVDAITNPTLEKETKTITRIHKAPKFPSHFGFWKRAEEERGGKSSGEKSRKTDGVGERAQAGEQREGPGQRAAALTDRQTDTAPSPSAHLLPGRRPTVDAAASGGQQPEPAPEGGVEGVGARGIALKLFVQLLGCSRSGGVVVRAGGAEPSGAARSVSSGREEPPPPPPEEEGEEEGEKEEERGPRWRLGAGEPGSWTGEAAVCADSAPAARAPQALARASAPGARGARGGAEESGPSRSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEEGDNKPHEVVKFMEVYRRSYCQPIETLVDIFQEYPDEIEYIFKPSCVPLVRCGGCCNDESLECVPTEEFNVTMQIMRIKPHQGQHIGEMSFLQHNKCECRCDKPRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Profilin-1 Human Recombinant
rAP-4573 1 Each

Profilin-1 Human Recombinant

Sign In for Pricing
View Details
GENLISA™ Human Carnitine Palmitoyltransferase 2, Mitochondrial (CPT2) ELISA
KBH20560 96 Well

GENLISA™ Human Carnitine Palmitoyltransferase 2, Mitochondrial (CPT2) ELISA

Sign In for Pricing
View Details
Recombinant Human TNFRSF17 / BCMA / CD269 Protein (His & Fc tag)
ARP7620-01 10 µg

Recombinant Human TNFRSF17 / BCMA / CD269 Protein (His & Fc tag)

Sign In for Pricing
View Details
Recombinant Human TNFRSF17 / BCMA / CD269 Protein (His & Fc tag)
ARP7620-02 50 µg

Recombinant Human TNFRSF17 / BCMA / CD269 Protein (His & Fc tag)

Sign In for Pricing
View Details
Recombinant Human TNFRSF17 / BCMA / CD269 Protein (His & Fc tag)
ARP7620-03 100 µg

Recombinant Human TNFRSF17 / BCMA / CD269 Protein (His & Fc tag)

Sign In for Pricing
View Details
Recombinant Human TNFRSF17 / BCMA / CD269 Protein (His & Fc tag)
ARP7620-04 1 mg

Recombinant Human TNFRSF17 / BCMA / CD269 Protein (His & Fc tag)

Sign In for Pricing
View Details