Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Vascular endothelial growth factor A (VEGFA)

Recombinant Rabbit Vascular endothelial growth factor A (VEGFA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rabbit (Oryctolagus cuniculus) . Target Name: VEGFA. Accession Number: XP_002714743.1. Expression Region: 51~511aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 65.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rabbit Vascular endothelial growth factor A (VEGFA) is a purified Recombinant Protein.

Accession Number

XP_002714743.1

Expression Region

51~511aa

Host

E. coli

Target

VEGFA

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

65.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Rabbit (Oryctolagus cuniculus)

Protein Name

Recombinant Protein

AA Sequence

YLWLLHAPLLHVSLDSLVAAFSVVFEVLPSSLDIPGSKKEEQASTQLGGVEEEHEASGVVTRQLAFVVDAITNPTLEKETKTITRIHKAPKFPSHFGFWKRAEEERGGKSSGEKSRKTDGVGERAQAGEQREGPGQRAAALTDRQTDTAPSPSAHLLPGRRPTVDAAASGGQQPEPAPEGGVEGVGARGIALKLFVQLLGCSRSGGVVVRAGGAEPSGAARSVSSGREEPPPPPPEEEGEEEGEKEEERGPRWRLGAGEPGSWTGEAAVCADSAPAARAPQALARASAPGARGARGGAEESGPSRSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEEGDNKPHEVVKFMEVYRRSYCQPIETLVDIFQEYPDEIEYIFKPSCVPLVRCGGCCNDESLECVPTEEFNVTMQIMRIKPHQGQHIGEMSFLQHNKCECRCDKPRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C18orf56 Protein Vector (Human) (pPM-C-His)
PV005392 500 ng

C18orf56 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Histone H3 (di methyl K36) Mouse Monoclonal Antibody (BF680)
orb2369108 100 µL

Histone H3 (di methyl K36) Mouse Monoclonal Antibody (BF680)

Sign In for Pricing
View Details
4-Bromo-6-chloropyridin-3-ol
OR1081086 1 Each

4-Bromo-6-chloropyridin-3-ol

Sign In for Pricing
View Details
mmu-miR-6928-5p Primers
MPM01669 150 µL / 10 µM

mmu-miR-6928-5p Primers

Sign In for Pricing
View Details
PNMA1 (Paraneoplastic Antigen Ma1, 37kD Neuronal Protein, Neuron- and Testis-specific Protein 1, MA1) APC
MBS6138334-01 0.1 mL

PNMA1 (Paraneoplastic Antigen Ma1, 37kD Neuronal Protein, Neuron- and Testis-specific Protein 1, MA1) APC

Sign In for Pricing
View Details
PNMA1 (Paraneoplastic Antigen Ma1, 37kD Neuronal Protein, Neuron- and Testis-specific Protein 1, MA1) APC
MBS6138334-02 5x 0.1 mL

PNMA1 (Paraneoplastic Antigen Ma1, 37kD Neuronal Protein, Neuron- and Testis-specific Protein 1, MA1) APC

Sign In for Pricing
View Details