Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ephrin-B1/EFNB1, Rat (HEK293, His)

Ephrin-B1/EFNB1 proteins bind to Eph receptors on neighboring cells and promote bidirectional signaling in developing neurons, blood vessels, and epithelia.It has high affinity for EPHB1/ELK, also binds EPHB2 and EPHB3, and induces commissural axon/growth cone collapse.Ephrin-B1/EFNB1 Protein, Rat (HEK293, His) is the recombinant rat-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Ephrin-B1/EFNB1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ephrin-b1-efnb1-protein-rat-hek293-his.html

Purity

98.0

Smiles

ATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPQQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQQEKSGPGAGGSGSGDT

Molecular Formula

25186 (Gene_ID) P52796 (A25-T229) (Accession)

Molecular Weight

Approximately 29-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1392 (NM_001001090) Rat Tagged ORF Clone Lentiviral Particle
RR201611L4V 200 µL

Olr1392 (NM_001001090) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
EPS15, CT (Epidermal Growth Factor Receptor Substrate 15, Protein Eps15, AF-1p protein, AF1P) (MaxLight 750) discontinued
E3376-04A-ML750 100 µL

EPS15, CT (Epidermal Growth Factor Receptor Substrate 15, Protein Eps15, AF-1p protein, AF1P) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Anti-Phospho-RAD52 (Y104) Antibody
P01580 100 µL

Anti-Phospho-RAD52 (Y104) Antibody

Sign In for Pricing
View Details
Lentiviral human GK5 shRNA (UAS) - Lentiviral human GK5 shRNA (UAS) (100)
GTR15090426 1 Vial

Lentiviral human GK5 shRNA (UAS) - Lentiviral human GK5 shRNA (UAS) (100)

Sign In for Pricing
View Details
Liarozole dihydrochloride
S6594-25mg 25 mg

Liarozole dihydrochloride

Sign In for Pricing
View Details
NODAL (Nodal Homolog (mouse), MGC138230, OTTHUMP00000019754) (FITC)
207818-FITC 100 µL

NODAL (Nodal Homolog (mouse), MGC138230, OTTHUMP00000019754) (FITC)

Sign In for Pricing
View Details