Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Negative regulator of flagellin synthesis (flgM)

Product Specifications

Product Name Alternative

(Anti-sigma-28 factor)

Abbreviation

Recombinant E.coli flgM protein

Gene Name

FlgM

UniProt

P0AEM4

Expression Region

1-97aa

Organism

Escherichia coli (strain K12)

Target Sequence

MSIDRTSPLKPVSTVQPRETTDAPVTNSRAAKTTASTSTSVTLSDAQAKLMQPGSSDINLERVEALKLAIRNGELKMDTGKIADALINEAQQDLQSN

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Responsible for the coupling of flagellin expression to flagellar assembly by preventing expression of the flagellin genes when a component of the middle class of proteins is defective. It negatively regulates flagellar genes by inhibiting the activity of FliA by directly binding to FliA.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.8 kDa

References & Citations

"The C-terminal half of the anti-sigma factor, FlgM, becomes structured when bound to its target, sigma 28." Daughdrill G.W., Chadsey M.S., Karlinsey J.E., Hughes K.T., Dahlquist F.W. Nat. Struct. Biol. 4:285-291 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Calponin 1 Antibody (rCNN1/832) [DyLight 405]
NBP2-54381V 100 µL

Mouse Monoclonal Calponin 1 Antibody (rCNN1/832) [DyLight 405]

Sign In for Pricing
View Details
PLV3-CMV-TAB2-3xFLAG-CopGFP-Puro Plasmid
PVT84982 2 µg

PLV3-CMV-TAB2-3xFLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cluster Of Differentiation 28 (CD28)
MBS2125820-01 0.1 mL

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 28 (CD28)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cluster Of Differentiation 28 (CD28)
MBS2125820-02 0.2 mL

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 28 (CD28)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cluster Of Differentiation 28 (CD28)
MBS2125820-03 0.5 mL

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 28 (CD28)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cluster Of Differentiation 28 (CD28)
MBS2125820-04 1 mL

APC-Linked Polyclonal Antibody to Cluster Of Differentiation 28 (CD28)

Sign In for Pricing
View Details