Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD276/B7-H3 (4Ig) /B7-H3b, Human (HEK293, His)

CD276/B7-H3 protein can regulate T cell-mediated immune responses and act as a protective factor for tumor cells by inhibiting natural killer-mediated cell lysis. It also functions as a neuroblastoma cell marker, plays a role in acute and chronic transplant rejection, and modulates lymphocyte activity at mucosal surfaces. CD276/B7-H3 (4Ig) /B7-H3b Protein, Human (HEK293, His) is the recombinant human-derived CD276/B7-H3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD276/B7-H3 (4Ig) /B7-H3b Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h3-icoslg-protein-human-433a-a-hek-293-his.html

Purity

98.0

Smiles

LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMT

Molecular Formula

80381 (Gene_ID) Q5ZPR3-1 (L29-T461) (Accession)

Molecular Weight

Approximately 65-90 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IgE Antibody (XTE4) [DyLight 755]
NB110-8339IR 0.2 mL

Mouse Monoclonal IgE Antibody (XTE4) [DyLight 755]

Sign In for Pricing
View Details
RAPSN CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
38512154 3x 1.0 µg DNA

RAPSN CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
FGFR1, phosphorylated (Y154) (Fibroblast Growth Factor Receptor 1, FGFR-1, 2.7.10.1, Basic fibroblast Growth Factor Receptor 1, BFGFR, bFGF-R-1, Fms-like Tyrosine Kinase 2, FLT-2, N-sam, Proto-Oncogene c-Fgr, CD331, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR, FGFR1) discontinued
222674-01 50 µL

FGFR1, phosphorylated (Y154) (Fibroblast Growth Factor Receptor 1, FGFR-1, 2.7.10.1, Basic fibroblast Growth Factor Receptor 1, BFGFR, bFGF-R-1, Fms-like Tyrosine Kinase 2, FLT-2, N-sam, Proto-Oncogene c-Fgr, CD331, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR, FGFR1) discontinued

Sign In for Pricing
View Details
FGFR1, phosphorylated (Y154) (Fibroblast Growth Factor Receptor 1, FGFR-1, 2.7.10.1, Basic fibroblast Growth Factor Receptor 1, BFGFR, bFGF-R-1, Fms-like Tyrosine Kinase 2, FLT-2, N-sam, Proto-Oncogene c-Fgr, CD331, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR, FGFR1) discontinued
222674-02 100 µL

FGFR1, phosphorylated (Y154) (Fibroblast Growth Factor Receptor 1, FGFR-1, 2.7.10.1, Basic fibroblast Growth Factor Receptor 1, BFGFR, bFGF-R-1, Fms-like Tyrosine Kinase 2, FLT-2, N-sam, Proto-Oncogene c-Fgr, CD331, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR, FGFR1) discontinued

Sign In for Pricing
View Details
Rabbit Monoclonal RAR alpha/NR1B1 Antibody (9C7R10)
NBP3-15770-100ul 100 µL

Rabbit Monoclonal RAR alpha/NR1B1 Antibody (9C7R10)

Sign In for Pricing
View Details
Human SORCS2 Protein Lysate 20ug
IHUSORCS2PLLY20UG 20 µg

Human SORCS2 Protein Lysate 20ug

Sign In for Pricing
View Details