Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRHBP, Human (HEK293, His)

CRHBP Protein critically regulates by binding to and inactivating corticotropin-releasing factor (CRF), suggesting a role in preventing excessive pituitary-adrenal stimulation, especially during pregnancy. This interaction contributes to balancing neuroendocrine signaling pathways, ensuring appropriate physiological responses and safeguarding against pituitary-adrenal axis overstimulation, particularly in the context of pregnancy. CRHBP Protein, Human (HEK293, His) is the recombinant human-derived CRHBP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CRHBP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/crhbp-protein-human-hek-293-his.html

Purity

98.5

Smiles

YLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL

Molecular Formula

1393 (Gene_ID) P24387 (Y25-L322) (Accession)

Molecular Weight

Approximately 40.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stag1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4489905 3x 1.0 µg

Stag1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
MYOT, ID (MYOT, TTID, Myotilin, 57kD cytoskeletal protein, Myofibrillar titin-like Ig domains protein, Titin immunoglobulin domain protein) (APC)
MBS6323529-01 0.2 mL

MYOT, ID (MYOT, TTID, Myotilin, 57kD cytoskeletal protein, Myofibrillar titin-like Ig domains protein, Titin immunoglobulin domain protein) (APC)

Sign In for Pricing
View Details
MYOT, ID (MYOT, TTID, Myotilin, 57kD cytoskeletal protein, Myofibrillar titin-like Ig domains protein, Titin immunoglobulin domain protein) (APC)
MBS6323529-02 5x 0.2 mL

MYOT, ID (MYOT, TTID, Myotilin, 57kD cytoskeletal protein, Myofibrillar titin-like Ig domains protein, Titin immunoglobulin domain protein) (APC)

Sign In for Pricing
View Details
GPS2 (G-Protein Pathway Suppressor 2, GPS-2, MGC104294, MGC119287, MGC119288, MGC119289) (MaxLight 650)
127508-ML650 100 µL

GPS2 (G-Protein Pathway Suppressor 2, GPS-2, MGC104294, MGC119287, MGC119288, MGC119289) (MaxLight 650)

Sign In for Pricing
View Details
ANIMALL CELL
409036/E 1 Each

ANIMALL CELL

Sign In for Pricing
View Details
OR8I2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1545008 1.0 µg DNA

OR8I2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details