Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRHBP, Human (HEK293, His)

CRHBP Protein critically regulates by binding to and inactivating corticotropin-releasing factor (CRF), suggesting a role in preventing excessive pituitary-adrenal stimulation, especially during pregnancy. This interaction contributes to balancing neuroendocrine signaling pathways, ensuring appropriate physiological responses and safeguarding against pituitary-adrenal axis overstimulation, particularly in the context of pregnancy. CRHBP Protein, Human (HEK293, His) is the recombinant human-derived CRHBP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CRHBP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/crhbp-protein-human-hek-293-his.html

Purity

98.5

Smiles

YLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL

Molecular Formula

1393 (Gene_ID) P24387 (Y25-L322) (Accession)

Molecular Weight

Approximately 40.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse AI182371 shRNA (UAS) - Lentiviral mouse AI182371 shRNA (UAS, iRFP) plasmid
GTR15199720 1 Vial

Lentiviral mouse AI182371 shRNA (UAS) - Lentiviral mouse AI182371 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
RCC1 (NM_001269) Human Tagged Lenti ORF Clone
RC221798L3 10 µg

RCC1 (NM_001269) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Autophagy Related Protein 7 (ATG7) Antibody
abx129917-01 100 µL

Autophagy Related Protein 7 (ATG7) Antibody

Sign In for Pricing
View Details
Autophagy Related Protein 7 (ATG7) Antibody
abx129917-02 200 µL

Autophagy Related Protein 7 (ATG7) Antibody

Sign In for Pricing
View Details
Autophagy Related Protein 7 (ATG7) Antibody
abx129917-03 1 mL

Autophagy Related Protein 7 (ATG7) Antibody

Sign In for Pricing
View Details
Flex-Column, Economy, 1.5 x 20.0 cm, 1 pc.
1219339 1 PC

Flex-Column, Economy, 1.5 x 20.0 cm, 1 pc.

Sign In for Pricing
View Details