Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRHBP, Human (HEK293, His)

CRHBP Protein critically regulates by binding to and inactivating corticotropin-releasing factor (CRF), suggesting a role in preventing excessive pituitary-adrenal stimulation, especially during pregnancy. This interaction contributes to balancing neuroendocrine signaling pathways, ensuring appropriate physiological responses and safeguarding against pituitary-adrenal axis overstimulation, particularly in the context of pregnancy. CRHBP Protein, Human (HEK293, His) is the recombinant human-derived CRHBP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CRHBP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/crhbp-protein-human-hek-293-his.html

Purity

98.5

Smiles

YLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL

Molecular Formula

1393 (Gene_ID) P24387 (Y25-L322) (Accession)

Molecular Weight

Approximately 40.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

R406 besylate 100mg
A10769-100 100 mg

R406 besylate 100mg

Sign In for Pricing
View Details
5'-ODMT cEt N-Bz A Phosphoramidite (Amidite)
MBS5816640 Inquire

5'-ODMT cEt N-Bz A Phosphoramidite (Amidite)

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD183/CXCR3 Antibody
RD30329F-01 20 Tests

PE/Cyanine7 Anti-Human CD183/CXCR3 Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD183/CXCR3 Antibody
RD30329F-02 100 Tests

PE/Cyanine7 Anti-Human CD183/CXCR3 Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD183/CXCR3 Antibody
RD30329F-03 2x 100 Tests

PE/Cyanine7 Anti-Human CD183/CXCR3 Antibody

Sign In for Pricing
View Details
5-Aza-2’-deoxyuridine (Beta Isomer Only)
TRC-A797125-10MG 10 mg

5-Aza-2’-deoxyuridine (Beta Isomer Only)

Sign In for Pricing
View Details