Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRHBP, Human (HEK293, His)

CRHBP Protein critically regulates by binding to and inactivating corticotropin-releasing factor (CRF), suggesting a role in preventing excessive pituitary-adrenal stimulation, especially during pregnancy. This interaction contributes to balancing neuroendocrine signaling pathways, ensuring appropriate physiological responses and safeguarding against pituitary-adrenal axis overstimulation, particularly in the context of pregnancy. CRHBP Protein, Human (HEK293, His) is the recombinant human-derived CRHBP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CRHBP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/crhbp-protein-human-hek-293-his.html

Purity

98.5

Smiles

YLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL

Molecular Formula

1393 (Gene_ID) P24387 (Y25-L322) (Accession)

Molecular Weight

Approximately 40.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIV-2 gp39, Polyclonal Rabbit Antibody (HIV-2 gp39 Antibody)
PT_73648-01 500 µg

HIV-2 gp39, Polyclonal Rabbit Antibody (HIV-2 gp39 Antibody)

Sign In for Pricing
View Details
HIV-2 gp39, Polyclonal Rabbit Antibody (HIV-2 gp39 Antibody)
PT_73648-02 1 mg

HIV-2 gp39, Polyclonal Rabbit Antibody (HIV-2 gp39 Antibody)

Sign In for Pricing
View Details
PCTP Antibody - middle region
MBS3221777-01 0.1 mL

PCTP Antibody - middle region

Sign In for Pricing
View Details
PCTP Antibody - middle region
MBS3221777-02 5x 0.1 mL

PCTP Antibody - middle region

Sign In for Pricing
View Details
Defb14 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6293005 3x 1.0 µg

Defb14 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Kxd1 (NM_029366) Mouse Tagged ORF Clone Lentiviral Particle
MR201550L4V 200 µL

Kxd1 (NM_029366) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details