Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRHBP, Human (HEK293, His)

CRHBP Protein critically regulates by binding to and inactivating corticotropin-releasing factor (CRF), suggesting a role in preventing excessive pituitary-adrenal stimulation, especially during pregnancy. This interaction contributes to balancing neuroendocrine signaling pathways, ensuring appropriate physiological responses and safeguarding against pituitary-adrenal axis overstimulation, particularly in the context of pregnancy. CRHBP Protein, Human (HEK293, His) is the recombinant human-derived CRHBP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CRHBP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/crhbp-protein-human-hek-293-his.html

Purity

98.5

Smiles

YLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL

Molecular Formula

1393 (Gene_ID) P24387 (Y25-L322) (Accession)

Molecular Weight

Approximately 40.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TdT Antibody (DNTT/1453) [DyLight 488]
NBP3-08563G 100 µL

Mouse Monoclonal TdT Antibody (DNTT/1453) [DyLight 488]

Sign In for Pricing
View Details
M15 (pREP4) Strains
STR0027 100 µL

M15 (pREP4) Strains

Sign In for Pricing
View Details
PDE1B Rabbit mAb
E60M0918 100 µL

PDE1B Rabbit mAb

Sign In for Pricing
View Details
Human Dual specificity phosphatase DUPD1 (DUPD1) ELISA Kit
abx384816 96 Tests

Human Dual specificity phosphatase DUPD1 (DUPD1) ELISA Kit

Sign In for Pricing
View Details
Fbln5 (NM_011812) Mouse Tagged ORF Clone
MR226107 10 µg

Fbln5 (NM_011812) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Shewanella sp. Argininosuccinate lyase (argH)
MBS1239375-01 0.02 mg (E-Coli)

Recombinant Shewanella sp. Argininosuccinate lyase (argH)

Sign In for Pricing
View Details