Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRHBP, Human (HEK293, His)

CRHBP Protein critically regulates by binding to and inactivating corticotropin-releasing factor (CRF), suggesting a role in preventing excessive pituitary-adrenal stimulation, especially during pregnancy. This interaction contributes to balancing neuroendocrine signaling pathways, ensuring appropriate physiological responses and safeguarding against pituitary-adrenal axis overstimulation, particularly in the context of pregnancy. CRHBP Protein, Human (HEK293, His) is the recombinant human-derived CRHBP protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CRHBP Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/crhbp-protein-human-hek-293-his.html

Purity

98.5

Smiles

YLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL

Molecular Formula

1393 (Gene_ID) P24387 (Y25-L322) (Accession)

Molecular Weight

Approximately 40.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGOLN2 (Trans-Golgi Network Integral Membrane Protein 2, TGN38 Homolog, TGN46, TGN48, Trans-Golgi Network Protein TGN51, TGN51, TTGN2)
134398 100 µg

TGOLN2 (Trans-Golgi Network Integral Membrane Protein 2, TGN38 Homolog, TGN46, TGN48, Trans-Golgi Network Protein TGN51, TGN51, TTGN2)

Sign In for Pricing
View Details
TAB1 (B-3) : m-IgG1 BP-HRP Bundle
sc-532514 1 Kit

TAB1 (B-3) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Human Keratin, type I cuticular Ha8, KRT38 ELISA KIT
ELI-12499h 96 Tests

Human Keratin, type I cuticular Ha8, KRT38 ELISA KIT

Sign In for Pricing
View Details
FKBP1C ORF Vector (Human) (pORF)
ORF019632 1.0 µg DNA

FKBP1C ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Lentiviral mouse Fam49a shRNA (UAS) - Lentiviral mouse Fam49a shRNA (UAS) (25)
GTR15182825 1 Vial

Lentiviral mouse Fam49a shRNA (UAS) - Lentiviral mouse Fam49a shRNA (UAS) (25)

Sign In for Pricing
View Details
TSC1, phosphorylated (S1130) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (MaxLight 750) discontinued
043311-ML750 100 µL

TSC1, phosphorylated (S1130) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (MaxLight 750) discontinued

Sign In for Pricing
View Details