Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAG-3, Canine (HEK293, Flag, His)

LAG-3 (lymphocyte activation gene 3) protein is expressed on antigen-activated T cells and transmits inhibitory signals by binding to ligands such as FGL1. FGL1 is the main ligand responsible for the suppressive function of LAG3 T cells. LAG-3 Protein, Canine (HEK293, Flag, His) is the recombinant canine-derived LAG-3 protein, expressed by HEK293 , with C-His, C-Flag labeled tag.

Product Specifications

Product Name Alternative

LAG-3 Protein, Canine (HEK293, Flag, His), Canine, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lag-3-protein-canine-hek293-flag-his.html

Purity

95.00

Smiles

PGSGTEVQVVWAQEGAPVQLPCSPTIPLQDVSLLRNAGVTWYHLPESGPAAPALSLRPAAPSARGPGPRSYVVLMRAPGGLRSGRPPLQPRVQLEERGLQRGDFSLWLRPARRADAGEYRAAVHLRDRSLACRLRLRVGQASMTASPPGALRISDWVILNCSFSRPDLPASVHWFRGRVPVPESPHYHLAGSFLFLPQISPSDSGPWGCTLTYRDGFNVSIMYNLTVLGLEPSGPLTVYTGAGSRVGLPCRLPPGVGTQSFLTAKWTPPGGGPDLLVAGDDGNFTLQLEVVNQAQAGTYTCHIHLQGQQLSTTVTLAVITVTPKSSGLPGNLRKLLCEVTPASGQERFVWSPLDKQSWRGSPGPCLEMQETRLLSQPWQCHVYQAERLLGTAVYLIDPAGPGAQRSGRAQGVLKTGHLS

Molecular Formula

/ (Gene_ID) A0A8C0JP39 (P23-S441) (Accession)

Molecular Weight

Approximately 47 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster IgG (H&L) Antibody - FITC Conjugated
OARA04892-1MG 1 mg

Hamster IgG (H&L) Antibody - FITC Conjugated

Sign In for Pricing
View Details
UVRAG Peptide - middle region (AAP84365)
AAP84365-100UG 100 µg

UVRAG Peptide - middle region (AAP84365)

Sign In for Pricing
View Details
Guinea Pig Mediator of RNA polymerase II transcription subunit 25 (MED25) ELISA Kit
GTR10364522 96 Well

Guinea Pig Mediator of RNA polymerase II transcription subunit 25 (MED25) ELISA Kit

Sign In for Pricing
View Details
5-Chloro-6-oxo-1,6-dihydro-3-pyridinecarbaldehyde
sc-318606A 1 g

5-Chloro-6-oxo-1,6-dihydro-3-pyridinecarbaldehyde

Sign In for Pricing
View Details
Tmem140 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3268003 1.0 µg DNA

Tmem140 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
1-Benzyl-1H-1,2,3,4-tetrazole
GAA92650-01 50 mg

1-Benzyl-1H-1,2,3,4-tetrazole

Sign In for Pricing
View Details