Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGP-2/MFAP5, Human (HEK293, His)

MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (HEK293, His) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

MAGP-2/MFAP5 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/magp-2-mfap5-protein-human-hek293-his.html

Purity

95.00

Smiles

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Molecular Formula

8076 (Gene_ID) Q13361-1 (I22-L173) (Accession)

Molecular Weight

Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2C Polyclonal Antibody, RBITC Conjugated
bs-8357R-RBITC 100 µL

UBE2C Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
YTHDF1 Rabbit Polyclonal Antibody
HA500350 100 µL

YTHDF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EOMES (NM_005442) Human Tagged ORF Clone Lentiviral Particle
RC221014L3V 200 µL

EOMES (NM_005442) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Zfp213 Rat shRNA Plasmid (Locus ID 287094)
TL704361 1 Kit

Zfp213 Rat shRNA Plasmid (Locus ID 287094)

Sign In for Pricing
View Details
CD18 Antibody
GWB-FAE1B1 0.1 mg

CD18 Antibody

Sign In for Pricing
View Details
Iris hybrid (IRA) (Biotin)
MBS656049-01 1 mg

Iris hybrid (IRA) (Biotin)

Sign In for Pricing
View Details