Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGP-2/MFAP5, Human (HEK293, His)

MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (HEK293, His) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

MAGP-2/MFAP5 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/magp-2-mfap5-protein-human-hek293-his.html

Purity

95.00

Smiles

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Molecular Formula

8076 (Gene_ID) Q13361-1 (I22-L173) (Accession)

Molecular Weight

Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM113B Protein Vector (Human) (pPB-N-His)
PV015006 500 ng

FAM113B Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
SPINK1 (Serine Protease Inhibitor Kazal-type 1, PCTT, PSTI, Spink3, TATI, TCP) (MaxLight 750)
MBS6438726-01 0.1 mL

SPINK1 (Serine Protease Inhibitor Kazal-type 1, PCTT, PSTI, Spink3, TATI, TCP) (MaxLight 750)

Sign In for Pricing
View Details
SPINK1 (Serine Protease Inhibitor Kazal-type 1, PCTT, PSTI, Spink3, TATI, TCP) (MaxLight 750)
MBS6438726-02 5x 0.1 mL

SPINK1 (Serine Protease Inhibitor Kazal-type 1, PCTT, PSTI, Spink3, TATI, TCP) (MaxLight 750)

Sign In for Pricing
View Details
Vascular Endothelial Growth Factor B (VEGFB, VEGF-B, VEGF-related Factor, VRF, VEGFL) APC
MBS6139832-01 0.1 mL

Vascular Endothelial Growth Factor B (VEGFB, VEGF-B, VEGF-related Factor, VRF, VEGFL) APC

Sign In for Pricing
View Details
Vascular Endothelial Growth Factor B (VEGFB, VEGF-B, VEGF-related Factor, VRF, VEGFL) APC
MBS6139832-02 5x 0.1 mL

Vascular Endothelial Growth Factor B (VEGFB, VEGF-B, VEGF-related Factor, VRF, VEGFL) APC

Sign In for Pricing
View Details
ST8 Adenovirus (Human)
45654051 1.0 mL

ST8 Adenovirus (Human)

Sign In for Pricing
View Details