Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Mouse (HEK293, hFc)

Growth differentiation factor 15 (GDF-15) is a polypeptide hormone belonging to the transforming growth factor β (TGF-β) superfamily. GDF-15 is also known as non-steroidal anti-inflammatory drug activating Gene-1 (NAG-1), placental transforming growth factor-β (PTGFB), prostate-derived factor (PDF), and placental bone morphogenetic protein (PLAB) . GDF-15 binds to glial cell-derived neurotrophic factor (GDNF) family receptor alpha-like protein (GFRAL) and is involved in aging, cancer, and metabolic processes. GFRAL-GDF15 does not affect SMAD activity and activates intracellular signals including RET, AKT, ERK1/2, and phospholipase C (PLCγ) [1]. GDF-15 Protein, Mouse (HEK293, hFc) has 115 amino acids expressed by HEK293 cells with N-terminal hFc tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-mouse-hek293-hfc.html

Purity

95.00

Smiles

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Formula

23886 (Gene_ID) Q9Z0J7 (S189-A303) (Accession)

Molecular Weight

Approximately 42 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ppp1cb (NM_172707) Mouse Tagged ORF Clone
MR204795 10 µg

Ppp1cb (NM_172707) Mouse Tagged ORF Clone

Ask
View Details
ACOX2 Polyclonal Antibody, APC-Cy7 Conjugated
bs-5030R-APC-Cy7 100 µL

ACOX2 Polyclonal Antibody, APC-Cy7 Conjugated

Ask
View Details
CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (HRP)
MBS6183238-01 0.1 mL

CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (HRP)

Ask
View Details
CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (HRP)
MBS6183238-02 5x 0.1 mL

CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (HRP)

Ask
View Details
hsa-miR-4262 miRNA Inhibitor
MBS8293855-01 10 nmol

hsa-miR-4262 miRNA Inhibitor

Ask
View Details
hsa-miR-4262 miRNA Inhibitor
MBS8293855-02 20 nmol

hsa-miR-4262 miRNA Inhibitor

Ask
View Details