GDF-15, Mouse (HEK293, hFc)
Growth differentiation factor 15 (GDF-15) is a polypeptide hormone belonging to the transforming growth factor β (TGF-β) superfamily. GDF-15 is also known as non-steroidal anti-inflammatory drug activating Gene-1 (NAG-1), placental transforming growth factor-β (PTGFB), prostate-derived factor (PDF), and placental bone morphogenetic protein (PLAB) . GDF-15 binds to glial cell-derived neurotrophic factor (GDNF) family receptor alpha-like protein (GFRAL) and is involved in aging, cancer, and metabolic processes. GFRAL-GDF15 does not affect SMAD activity and activates intracellular signals including RET, AKT, ERK1/2, and phospholipase C (PLCγ) [1]. GDF-15 Protein, Mouse (HEK293, hFc) has 115 amino acids expressed by HEK293 cells with N-terminal hFc tag.
Product Specifications
Product Name Alternative
GDF-15 Protein, Mouse (HEK293, hFc), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gdf-15-protein-mouse-hek293-hfc.html
Purity
95.00
Smiles
SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA
Molecular Formula
23886 (Gene_ID) Q9Z0J7 (S189-A303) (Accession)
Molecular Weight
Approximately 42 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Rabbit anti-Escherichia coli (strain K12/DH10B) YIHI Polyclonal Antibody
Platelet Basic Protein, CT (PBP, C-X-C Motif Chemokine 7, Leukocyte-derived Growth Factor, LDGF, Macrophage-derived Growth Factor, MDGF, CXCL7, Small-inducible Cytokine B7) (FITC)
Platelet Basic Protein, CT (PBP, C-X-C Motif Chemokine 7, Leukocyte-derived Growth Factor, LDGF, Macrophage-derived Growth Factor, MDGF, CXCL7, Small-inducible Cytokine B7) (FITC)