Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Mouse (HEK293, hFc)

Growth differentiation factor 15 (GDF-15) is a polypeptide hormone belonging to the transforming growth factor β (TGF-β) superfamily. GDF-15 is also known as non-steroidal anti-inflammatory drug activating Gene-1 (NAG-1), placental transforming growth factor-β (PTGFB), prostate-derived factor (PDF), and placental bone morphogenetic protein (PLAB) . GDF-15 binds to glial cell-derived neurotrophic factor (GDNF) family receptor alpha-like protein (GFRAL) and is involved in aging, cancer, and metabolic processes. GFRAL-GDF15 does not affect SMAD activity and activates intracellular signals including RET, AKT, ERK1/2, and phospholipase C (PLCγ) [1]. GDF-15 Protein, Mouse (HEK293, hFc) has 115 amino acids expressed by HEK293 cells with N-terminal hFc tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-mouse-hek293-hfc.html

Purity

95.00

Smiles

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Formula

23886 (Gene_ID) Q9Z0J7 (S189-A303) (Accession)

Molecular Weight

Approximately 42 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Hmces (NM_173737) Mouse Tagged ORF Clone Lentiviral Particle
MR205366L4V 200 µL

Hmces (NM_173737) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
Lentiviral mouse Fdx2 shRNA (UAS) - Lentiviral mouse Fdx2 shRNA (UAS, GFP) (100)
GTR15273621 1 Vial

Lentiviral mouse Fdx2 shRNA (UAS) - Lentiviral mouse Fdx2 shRNA (UAS, GFP) (100)

Ask
View Details
Human APLNR Protein, hFc Tag
E33P101471 10 µg

Human APLNR Protein, hFc Tag

Ask
View Details
Lentiviral human SELENOM shRNA (UAS) - Lentiviral human SELENOM shRNA (UAS, GFP) (25)
GTR15088616 1 Vial

Lentiviral human SELENOM shRNA (UAS) - Lentiviral human SELENOM shRNA (UAS, GFP) (25)

Ask
View Details
APOE3 Human
PT-A00266-01 100 µg

APOE3 Human

Ask
View Details
APOE3 Human
PT-A00266-02 1 mg

APOE3 Human

Ask
View Details