Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF-15, Mouse (HEK293, hFc)

Growth differentiation factor 15 (GDF-15) is a polypeptide hormone belonging to the transforming growth factor β (TGF-β) superfamily. GDF-15 is also known as non-steroidal anti-inflammatory drug activating Gene-1 (NAG-1), placental transforming growth factor-β (PTGFB), prostate-derived factor (PDF), and placental bone morphogenetic protein (PLAB) . GDF-15 binds to glial cell-derived neurotrophic factor (GDNF) family receptor alpha-like protein (GFRAL) and is involved in aging, cancer, and metabolic processes. GFRAL-GDF15 does not affect SMAD activity and activates intracellular signals including RET, AKT, ERK1/2, and phospholipase C (PLCγ) [1]. GDF-15 Protein, Mouse (HEK293, hFc) has 115 amino acids expressed by HEK293 cells with N-terminal hFc tag.

Product Specifications

Product Name Alternative

GDF-15 Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdf-15-protein-mouse-hek293-hfc.html

Purity

95.00

Smiles

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Molecular Formula

23886 (Gene_ID) Q9Z0J7 (S189-A303) (Accession)

Molecular Weight

Approximately 42 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human DNA repair protein XRCC4 Protein, GST, E.coli-200ug
QP7540-ec-200ug 200ug

Recombinant Human DNA repair protein XRCC4 Protein, GST, E.coli-200ug

Ask
View Details
WD repeat and FYVE domain-containing protein 3 (WDFY3) Antibody (Biotin)
abx338304-01 20 µg

WD repeat and FYVE domain-containing protein 3 (WDFY3) Antibody (Biotin)

Ask
View Details
WD repeat and FYVE domain-containing protein 3 (WDFY3) Antibody (Biotin)
abx338304-02 50 µg

WD repeat and FYVE domain-containing protein 3 (WDFY3) Antibody (Biotin)

Ask
View Details
WD repeat and FYVE domain-containing protein 3 (WDFY3) Antibody (Biotin)
abx338304-03 100 µg

WD repeat and FYVE domain-containing protein 3 (WDFY3) Antibody (Biotin)

Ask
View Details
WD repeat and FYVE domain-containing protein 3 (WDFY3) Antibody (Biotin)
abx338304-04 200 µg

WD repeat and FYVE domain-containing protein 3 (WDFY3) Antibody (Biotin)

Ask
View Details
WD repeat and FYVE domain-containing protein 3 (WDFY3) Antibody (Biotin)
abx338304-05 1 mg

WD repeat and FYVE domain-containing protein 3 (WDFY3) Antibody (Biotin)

Ask
View Details