Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEPT12 Rabbit Polyclonal Antibody

Rabbit polyclonal antibody to SEPT12 .

Product Specifications

Product Name Alternative

SEPT12, SPGF10

UniProt

Q8IYM1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SEPT12

Target

SEPT12

Clonality

Polyclonal

Conjugation

Unconjugated

Sequence

Synthetic peptide located within the following region: LQRLCRTVNVVPVIARADSLTMEEREAFRRRIQQNLRTHCIDVYPQMCFD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Concentration

0.5 mg/ml

Form

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Molecular Weight

41kDa

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_653206

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Type IV Peptide Arginine Deaminase (PAD4) ELISA Kit
OM626389 96 Tests

Bovine Type IV Peptide Arginine Deaminase (PAD4) ELISA Kit

Sign In for Pricing
View Details
GZMA (CTL tryptase, CTLA3, Cytolytic t Cell and Natural Killer Cell specific trypsin like Serine Protease, Cytotoxic T Lymphocyte Associated Serine esterase 3, Cytotoxic T Lymphocyte Proteinase 1, Cytotoxic T-Lymphocyte Proteinase 1, Fragmentin 1, Fragmentin-1, GRAA_HUMAN, Granzyme 1 cytotoxic T Lymphocyte Associated Serine esterase 3, Granzyme A (Cytotoxic T Lymphocyte Associated Serine esterase 3, Hanukah Factor Serine Protease), Granzyme A (granzyme 1, cytotoxic T Lymphocyte Associated Serine esterase 3), Granzyme A, Granzyme A Precursor, Granzyme-1, GZMA, H Factor, Hanukah Factor Serine Protease, Hanukkah Factor, HF, HFSP, TSP1, ) discontinued
223134-01 50 µL

GZMA (CTL tryptase, CTLA3, Cytolytic t Cell and Natural Killer Cell specific trypsin like Serine Protease, Cytotoxic T Lymphocyte Associated Serine esterase 3, Cytotoxic T Lymphocyte Proteinase 1, Cytotoxic T-Lymphocyte Proteinase 1, Fragmentin 1, Fragmentin-1, GRAA_HUMAN, Granzyme 1 cytotoxic T Lymphocyte Associated Serine esterase 3, Granzyme A (Cytotoxic T Lymphocyte Associated Serine esterase 3, Hanukah Factor Serine Protease), Granzyme A (granzyme 1, cytotoxic T Lymphocyte Associated Serine esterase 3), Granzyme A, Granzyme A Precursor, Granzyme-1, GZMA, H Factor, Hanukah Factor Serine Protease, Hanukkah Factor, HF, HFSP, TSP1, ) discontinued

Sign In for Pricing
View Details
GZMA (CTL tryptase, CTLA3, Cytolytic t Cell and Natural Killer Cell specific trypsin like Serine Protease, Cytotoxic T Lymphocyte Associated Serine esterase 3, Cytotoxic T Lymphocyte Proteinase 1, Cytotoxic T-Lymphocyte Proteinase 1, Fragmentin 1, Fragmentin-1, GRAA_HUMAN, Granzyme 1 cytotoxic T Lymphocyte Associated Serine esterase 3, Granzyme A (Cytotoxic T Lymphocyte Associated Serine esterase 3, Hanukah Factor Serine Protease), Granzyme A (granzyme 1, cytotoxic T Lymphocyte Associated Serine esterase 3), Granzyme A, Granzyme A Precursor, Granzyme-1, GZMA, H Factor, Hanukah Factor Serine Protease, Hanukkah Factor, HF, HFSP, TSP1, ) discontinued
223134-02 100 µL

GZMA (CTL tryptase, CTLA3, Cytolytic t Cell and Natural Killer Cell specific trypsin like Serine Protease, Cytotoxic T Lymphocyte Associated Serine esterase 3, Cytotoxic T Lymphocyte Proteinase 1, Cytotoxic T-Lymphocyte Proteinase 1, Fragmentin 1, Fragmentin-1, GRAA_HUMAN, Granzyme 1 cytotoxic T Lymphocyte Associated Serine esterase 3, Granzyme A (Cytotoxic T Lymphocyte Associated Serine esterase 3, Hanukah Factor Serine Protease), Granzyme A (granzyme 1, cytotoxic T Lymphocyte Associated Serine esterase 3), Granzyme A, Granzyme A Precursor, Granzyme-1, GZMA, H Factor, Hanukah Factor Serine Protease, Hanukkah Factor, HF, HFSP, TSP1, ) discontinued

Sign In for Pricing
View Details
RPS27P24 ORF Vector (Human) (pORF)
ORF031513 1.0 µg DNA

RPS27P24 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
FIT1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV814479 1.0 µg DNA

FIT1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ZDHHC13 siRNA (Mouse)
MBS8236772-01 15 nmol

ZDHHC13 siRNA (Mouse)

Sign In for Pricing
View Details