What is the catalog number for CXCL12 Rabbit Polyclonal Antibody?

The catalog number for CXCL12 Rabbit Polyclonal Antibody is orb333745.

What sizes are available for CXCL12 Rabbit Polyclonal Antibody?

CXCL12 Rabbit Polyclonal Antibody is available in the following size(s): 100 µL.

Is CXCL12 Rabbit Polyclonal Antibody in stock?

CXCL12 Rabbit Polyclonal Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

CXCL12 Rabbit Polyclonal Antibody

Rabbit polyclonal antibody to SDF1

Product Specifications

Product Name Alternative

Anti C-X-C motif chemokine 12 antibody, anti CXCL12 antibody, anti CXCL-12 antibody, anti CXCL 12 antibody, anti hIRH antibody, anti hSDF-1 antibody, anti Intercrine reduced in hepatomas antibody, anti IRH antibody, anti PBSF antibody, anti SCYB12 antibody, anti SDF 1 alpha antibody, anti SDF 1 antibody, anti SDF 1 beta antibody, anti SDF 1b antibody, anti SDF-1 antibody, anti SDF-1a antibody, anti SDF-1b antibody, anti SDF1 antibody, anti SDF1a antibody, anti SDF1b antibody, anti Stromal cell derived factor 1 antibody, anti TLSF a antibody, anti TLSF antibody, anti TLSF b antibody, anti TLSF-a antibody, anti TLSF-b antibody, anti TLSFa antibody, anti TLSFb antibody, anti TPAR1 antibody

UniProt

P48061

Reactivity

Human, Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CXCL12

Target

CXCL12

Clonality

Polyclonal

Conjugation

Unconjugated

Sequence

Synthetic peptide located within the following region: VKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Concentration

0.5 mg/ml

Form

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Molecular Weight

11 kDa

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_000600

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS1224637-01 0.02 mg (E-Coli)

Recombinant Pseudotsuga menziesii Isoflavone reductase homolog 1

Sign In for Pricing

View Details

MBS1224637-02 0.1 mg (E-Coli)

Recombinant Pseudotsuga menziesii Isoflavone reductase homolog 1

Sign In for Pricing

View Details

MBS1224637-03 0.02 mg (Yeast)

Recombinant Pseudotsuga menziesii Isoflavone reductase homolog 1

Sign In for Pricing

View Details

MBS1224637-04 0.1 mg (Yeast)

Recombinant Pseudotsuga menziesii Isoflavone reductase homolog 1

Sign In for Pricing

View Details

MBS1224637-05 0.02 mg (Baculovirus)

Recombinant Pseudotsuga menziesii Isoflavone reductase homolog 1

Sign In for Pricing

View Details

MBS1224637-06 1 mg (E-Coli)

Recombinant Pseudotsuga menziesii Isoflavone reductase homolog 1

Sign In for Pricing

View Details